Rv1993c Family assigned · low auto-curated

H37Rv Rv1993c · MTBC0 mtbc0_002120 · 90 aa · 2260916–2261188 (-) · RefSeq NP_216509.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF1490 family protein
Revised (this work)DUF1490 family protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WLP5 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv1993c

UniProt still lists this protein as Uncharacterized protein Rv1993c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF1490)
Orthologous group2ET5E
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF1490PF07371.18 4.4e-391–86 Protein of unknown function (DUF1490)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ctpG (cation transporter ATPase G), high confidence from genomic context alone (score 963 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1992c ctpG cation transporter ATPase G 992 963 ctx neighborhood:801 coexpression:820 textmining:802
Rv1994c cmtR HTH-type transcriptional regulator CmtR 935 684 ctx neighborhood:680 textmining:805
Rv1991c mazF6 mRNA interferase MazF6 550 550 ctx neighborhood:536
Rv1991A mazE6 antitoxin MazE6 536 536 ctx neighborhood:536
Rv1995 hyp hypothetical protein 918 430 ctx neighborhood:425 textmining:862
Rv1977 hyp hypothetical protein 546 50 textmining:542
Rv1333 hydrolase 434 44 textmining:433
Rv2075c hyp hypothetical protein 650 41 textmining:650
Rv1521 fadD25 fatty-acid--CoA ligase FadD25 517 41 textmining:517
Rv1979c permease 432 41 textmining:432

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: DUF1490 family protein
  • Pfam (hmmscan --cut_ga): DUF1490 PF07371.18 (E=4e-39)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216509.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF1490 (PF07371.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2ET5E
  • Curated reference: UniProt P9WLP5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 10 functional partner(s); context anchor ctpG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002120|Rv1993c|
MVTHELLVKAAGAVLTGLVGVSAYETLRKALGTAPIRRASVTVMEWGLRGTRRAEAAAESARLTVADVVAEARGRIGEEAPLPAGARVDE