mpt64 Resolved · medium auto-curated
H37Rv Rv1980c · MTBC0 mtbc0_002102 ·
228 aa · 2246956–2247642 (-) ·
RefSeq NP_216496.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | immunogenic protein Mpt64 |
|---|---|
| MTBC0 PGAP re-annotation | immunoprotective protein Mpt64 |
| Revised (this work) | Immunoprotective protein Mpt64. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WIN9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Immunogenic protein MPT64 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | mpt64 |
| eggNOG description | Protein of unknown function (DUF3298) |
| Orthologous group | 28KR0 |
| Gene Ontology (27) |
GO:0003674, GO:0005488, GO:0005515, GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0006950, GO:0007154, GO:0008150, GO:0009267, GO:0009605 +15 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.625 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF3298 | PF11738.14 | 1.6e-16 | 146–221 | Protein of unknown function (DUF3298) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1979c (permease), medium confidence from genomic context alone (score 569 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1979c |
permease | 735 | 569 ctx | neighborhood:475 textmining:411 |
Rv1981c nrdF1 |
ribonucleoside-diphosphate reductase subunit beta NrdF1 | 864 | 476 ctx | neighborhood:468 textmining:752 |
Rv3804c fbpA |
diacylglycerol acyltransferase/mycolyltransferase Ag85A | 855 | 65 | textmining:852 |
Rv0934 pstS1 |
phosphate ABC transporter substrate-binding lipoprotein PstS | 853 | 55 | textmining:852 |
Rv0667 rpoB |
DNA-directed RNA polymerase subunit beta | 507 | 55 | textmining:500 |
Rv2945c lppX |
lipoprotein LppX | 487 | 55 | textmining:480 |
Rv1876 bfrA |
bacterioferritin BfrA | 434 | 55 | textmining:426 |
Rv2376c cfp2 |
low molecular weight antigen MTB12 | 545 | 54 | textmining:540 |
Rv2878c mpt53 |
soluble secreted antigen Mpt53 | 462 | 52 | textmining:457 |
Rv1886c fbpB |
diacylglycerol acyltransferase/mycolyltransferase Ag85B | 936 | 51 | textmining:936 |
Rv1984c cfp21 |
cutinase | 809 | 51 | textmining:807 |
Rv3418c groES |
chaperonin GroES | 771 | 50 | textmining:770 |
Rv0288 esxH |
ESAT-6-like protein EsxH | 553 | 50 | textmining:549 |
Rv3875 esxA |
ESAT-6 protein EsxA | 926 | 47 | textmining:926 |
Rv0350 dnaK |
chaperone protein DnaK | 787 | 47 | textmining:786 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: immunogenic protein Mpt64
- MTBC0 PGAP product: immunoprotective protein Mpt64
- Pfam (hmmscan --cut_ga): DUF3298 PF11738.14 (E=2e-16)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216496.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF3298 (PF11738.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
28KR0 - Curated reference: UniProt P9WIN9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
34 functional partner(s); context anchor
Rv1979c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002102|Rv1980c|mpt64 MRIKIFMLVTAVVLLCCSGVATAAPKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA