mpt64 Resolved · medium auto-curated

H37Rv Rv1980c · MTBC0 mtbc0_002102 · 228 aa · 2246956–2247642 MTBC0 (-) · RefSeq NP_216496.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)immunogenic protein Mpt64
MTBC0 PGAP re-annotationimmunoprotective protein Mpt64
Revised (this work)Immunoprotective protein Mpt64.
Functional category (TubercuList)cell wall and cell processes

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 368 publications

368 TB publications mention this gene. 368 publication(s) discuss this gene (362 in a M. tuberculosis context, 20 in other mycobacteria — M. abscessus (12), M. leprae (4), M. smegmatis (3), M. marinum (1)).

Most recent 5 of 368.
PublicationDate
From immunoinformatics insights to assay development: establishment of a peptide-based indirect elisa for cynomolgus tuberculosis detection. doi:10.3389/fcimb.2026.1799877 2026
Advances in electrochemical immunosensors for tuberculosis detection: a systematic review. doi:10.1016/j.btre.2026.e00967 2026
Performance and Cost-Efficiency of an MPT64 Assay for Detecting Mycobacterium tuberculosis Complex in a Setting With Frequent Nontuberculous Mycobacteria Isolation. doi:10.3346/jkms.2026.41.e9 2026
Detection of Mycobacterium tuberculosis antigens in urinary extracellular vesicles using real-time immuno-PCR: A non-invasive diagnostic approach for pulmonary tuberculosis. doi:10.1038/s41598-026-55896-w 2026
Stepwise PEG Precipitation Coupled with Hydrophobic Interaction Chromatography Enables the Production of Highly Specific Anti-Ag85B IgY for Tuberculosis Immunodiagnostics. doi:10.2147/IDR.S610371 2026

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 1.10 (95% CI -0.58 to 3.86). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2002c · 100.0% identity
M. marinum MMAR_5409 · 65.8% identity
M. orygis RJtmp_002042 · 100.0% identity
M. abscessus MAB_1835c · 43.9% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WIN9 SwissProt · reviewed · Evidence at protein level
UniProt nameImmunogenic protein MPT64

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namempt64
eggNOG descriptionProtein of unknown function (DUF3298)
Orthologous group28KR0
Gene Ontology (27) GO:0003674, GO:0005488, GO:0005515, GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0006950, GO:0007154, GO:0008150, GO:0009267, GO:0009605 +15 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.625 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Mycobacteriaceae

M. canettii dN/dS (deep-divergence selection) inf (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 52/53 (98%) · mean identity 52.8% · 4/4 closest MTBAP relatives
conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 1/13 non-Mycobacterium reference genomes (down to Mycobacteriaceae) · mean identity 43.7%
detected in the sister family Mycobacteriaceae (M. abscessus) but not in the broader Corynebacteriales — a Mycobacteriaceae-restricted gene (single-genome rung: interpret with care)

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callGA · growth-advantage
What the call meansgrowth-advantage: insertions enriched
TA sites (Himar1) 20 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 20 growth-advantage. Saturation 1.000, mean read count 269.45. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection (in vivo) +1.120.0094 disruption advantageous

Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 16 of 16 independent MS datasets
Integrated abundance2552.0 ppm · rank 50/3519 (98.6th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Predicted localisation (DeepTMHMM + lipobox) signal peptide

Predictionpredicted secreted protein (signal peptide)
DeepTMHMM classSP

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length228 aa
Molecular weight24.9 kDa
Theoretical pI4.84
GRAVY-0.137 (hydrophilic)
Aliphatic index82.2
Aromaticity0.096
Instability index28.7 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF3298PF11738.14 1.6e-16146–221 Protein of unknown function (DUF3298)

Experimental structures (Protein Data Bank) 1 solved

PDBMethodResolutionCoverage
2hhi Solution NMR 99%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 87.7

PDB hitprobTM-scoreE-valueDescription
2hhi-assembly1_A 1.00 0.63 9.9e-28 sig 2hhi-assembly1_A The solution structure of antigen MPT64 from Mycobacterium tuberculosis defines a novel class of beta-grasp proteins
3cyg-assembly2_A 1.00 0.70 1.2e-11 sig 3cyg-assembly2_A Crystal structure of an uncharacterized protein from Fervidobacterium nodosum Rt17-B1
3cyg-assembly3_B 1.00 0.72 1.2e-10 sig 3cyg-assembly3_B Crystal structure of an uncharacterized protein from Fervidobacterium nodosum Rt17-B1
5jen-assembly2_C 1.00 0.65 1.1e-09 sig 5jen-assembly2_C Crystal structure of the anti-sigma factor RsiV bound to lysozyme
5jen-assembly1_A 1.00 0.62 2.1e-10 sig 5jen-assembly1_A Crystal structure of the anti-sigma factor RsiV bound to lysozyme

Foldseek search of the AlphaFold DB model (mean pLDDT 87.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)Rv1979c (- strand, 178 bp gap)
Downstream (3' on genome)nrdF1 (- strand, 190 bp gap)

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv1979c (permease), medium confidence from genomic context alone (score 569 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1979c permease 735 569 ctx neighborhood:475 textmining:411
Rv1981c nrdF1 ribonucleoside-diphosphate reductase subunit beta NrdF1 864 476 ctx neighborhood:468 textmining:752
Rv3804c fbpA diacylglycerol acyltransferase/mycolyltransferase Ag85A 855 65 textmining:852
Rv0934 pstS1 phosphate ABC transporter substrate-binding lipoprotein PstS 853 55 textmining:852
Rv0667 rpoB DNA-directed RNA polymerase subunit beta 507 55 textmining:500
Rv2945c lppX lipoprotein LppX 487 55 textmining:480
Rv1876 bfrA bacterioferritin BfrA 434 55 textmining:426
Rv2376c cfp2 low molecular weight antigen MTB12 545 54 textmining:540
Rv2878c mpt53 soluble secreted antigen Mpt53 462 52 textmining:457
Rv1886c fbpB diacylglycerol acyltransferase/mycolyltransferase Ag85B 936 51 textmining:936
Rv1984c cfp21 cutinase 809 51 textmining:807
Rv3418c groES chaperonin GroES 771 50 textmining:770
Rv0288 esxH ESAT-6-like protein EsxH 553 50 textmining:549
Rv3875 esxA ESAT-6 protein EsxA 926 47 textmining:926
Rv0350 dnaK chaperone protein DnaK 787 47 textmining:786

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: immunogenic protein Mpt64
  • MTBC0 PGAP product: immunoprotective protein Mpt64
  • Pfam (hmmscan --cut_ga): DUF3298 PF11738.14 (E=2e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216496.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF3298 (PF11738.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 28KR0
  • Curated reference: UniProt P9WIN9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 87.7)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 34 functional partner(s); context anchor Rv1979c
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002102|Rv1980c|mpt64
MRIKIFMLVTAVVLLCCSGVATAAPKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA