mpt64 Resolved · medium auto-curated

H37Rv Rv1980c · MTBC0 mtbc0_002102 · 228 aa · 2246956–2247642 (-) · RefSeq NP_216496.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)immunogenic protein Mpt64
MTBC0 PGAP re-annotationimmunoprotective protein Mpt64
Revised (this work)Immunoprotective protein Mpt64.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIN9 SwissProt · reviewed · Evidence at protein level
UniProt nameImmunogenic protein MPT64

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namempt64
eggNOG descriptionProtein of unknown function (DUF3298)
Orthologous group28KR0
Gene Ontology (27) GO:0003674, GO:0005488, GO:0005515, GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0006950, GO:0007154, GO:0008150, GO:0009267, GO:0009605 +15 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.625 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF3298PF11738.14 1.6e-16146–221 Protein of unknown function (DUF3298)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1979c (permease), medium confidence from genomic context alone (score 569 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1979c permease 735 569 ctx neighborhood:475 textmining:411
Rv1981c nrdF1 ribonucleoside-diphosphate reductase subunit beta NrdF1 864 476 ctx neighborhood:468 textmining:752
Rv3804c fbpA diacylglycerol acyltransferase/mycolyltransferase Ag85A 855 65 textmining:852
Rv0934 pstS1 phosphate ABC transporter substrate-binding lipoprotein PstS 853 55 textmining:852
Rv0667 rpoB DNA-directed RNA polymerase subunit beta 507 55 textmining:500
Rv2945c lppX lipoprotein LppX 487 55 textmining:480
Rv1876 bfrA bacterioferritin BfrA 434 55 textmining:426
Rv2376c cfp2 low molecular weight antigen MTB12 545 54 textmining:540
Rv2878c mpt53 soluble secreted antigen Mpt53 462 52 textmining:457
Rv1886c fbpB diacylglycerol acyltransferase/mycolyltransferase Ag85B 936 51 textmining:936
Rv1984c cfp21 cutinase 809 51 textmining:807
Rv3418c groES chaperonin GroES 771 50 textmining:770
Rv0288 esxH ESAT-6-like protein EsxH 553 50 textmining:549
Rv3875 esxA ESAT-6 protein EsxA 926 47 textmining:926
Rv0350 dnaK chaperone protein DnaK 787 47 textmining:786

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: immunogenic protein Mpt64
  • MTBC0 PGAP product: immunoprotective protein Mpt64
  • Pfam (hmmscan --cut_ga): DUF3298 PF11738.14 (E=2e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216496.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF3298 (PF11738.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 28KR0
  • Curated reference: UniProt P9WIN9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 34 functional partner(s); context anchor Rv1979c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002102|Rv1980c|mpt64
MRIKIFMLVTAVVLLCCSGVATAAPKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA