cfp2 Resolved · high auto-curated
H37Rv Rv2376c · MTBC0 mtbc0_002528 ·
168 aa · 2679802–2680308 (-) ·
RefSeq NP_216892.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | low molecular weight antigen MTB12 |
|---|---|
| MTBC0 PGAP re-annotation | Low molecular weight antigen MTB12 |
| Revised (this work) | Low molecular weight antigen MTB12. Pfam: Mtb12_C (PF26580.1). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WIN7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Low molecular weight antigen MTB12 |
| Curated function | May play a role in the development of protective immune responses. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Preferred name | cfp2 |
|---|---|
| Orthologous group | 2AP6Z |
| Gene Ontology (7) |
GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.357 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Mtb12_C | PF26580.1 | 1.6e-25 | 55–167 | Low molecular weight antigen MTB12, C-terminal domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mbtG (L-lysine N6-monooxygenase), medium confidence from genomic context alone (score 574 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2377c mbtH hyp |
hypothetical protein | 574 | 574 ctx | neighborhood:574 |
Rv2378c mbtG |
L-lysine N6-monooxygenase | 574 | 574 ctx | neighborhood:574 |
Rv2379c mbtF |
peptide synthetase | 545 | 545 ctx | neighborhood:544 |
Rv2380c mbtE |
peptide synthetase | 544 | 543 ctx | neighborhood:543 |
Rv1980c mpt64 |
immunogenic protein Mpt64 | 545 | 54 | textmining:540 |
Rv2785c rpsO |
30S ribosomal protein S15 | 516 | 53 | textmining:510 |
Rv1639c hyp |
hypothetical protein | 571 | 52 | textmining:567 |
Rv3874 esxB |
ESAT-6-like protein EsxB | 445 | 51 | textmining:440 |
Rv3004 cfp6 |
low molecular weight protein antigen 6 | 434 | 46 | textmining:432 |
Rv2537c aroD |
3-dehydroquinate dehydratase | 433 | 46 | textmining:431 |
Rv3419c gcp |
O-sialoglycoprotein endopeptidase | 414 | 46 | textmining:411 |
Rv3477 PE31 |
PE family protein PE31 | 542 | 41 | textmining:542 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: low molecular weight antigen MTB12
- MTBC0 PGAP product: Low molecular weight antigen MTB12
- Pfam (hmmscan --cut_ga): Mtb12_C PF26580.1 (E=2e-25)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216892.1)
- Domains: Pfam-A via hmmscan --cut_ga — Mtb12_C (PF26580.1)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2AP6Z - Curated reference: UniProt P9WIN7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
12 functional partner(s); context anchor
mbtG - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002528|Rv2376c|cfp2 MKMVKSIAAGLTAAAAIGAAAAGVTSIMAGGPVVYQMQPVVFGAPLPLDPASAPDVPTAAQLTSLLNSLADPNVSFANKGSLVEGGIGGTEARIADHKLKKAAEHGDLPLSFSVTNIQPAAAGSATADVSVSGPKLSSPVTQNVTFVNQGGWMLSRASAMELLQAAGN