cfp2 Resolved · high auto-curated

H37Rv Rv2376c · MTBC0 mtbc0_002528 · 168 aa · 2679802–2680308 (-) · RefSeq NP_216892.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)low molecular weight antigen MTB12
MTBC0 PGAP re-annotationLow molecular weight antigen MTB12
Revised (this work)Low molecular weight antigen MTB12. Pfam: Mtb12_C (PF26580.1).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIN7 SwissProt · reviewed · Evidence at protein level
UniProt nameLow molecular weight antigen MTB12
Curated functionMay play a role in the development of protective immune responses.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Preferred namecfp2
Orthologous group2AP6Z
Gene Ontology (7) GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.357 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Mtb12_CPF26580.1 1.6e-2555–167 Low molecular weight antigen MTB12, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mbtG (L-lysine N6-monooxygenase), medium confidence from genomic context alone (score 574 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2377c mbtH hyp hypothetical protein 574 574 ctx neighborhood:574
Rv2378c mbtG L-lysine N6-monooxygenase 574 574 ctx neighborhood:574
Rv2379c mbtF peptide synthetase 545 545 ctx neighborhood:544
Rv2380c mbtE peptide synthetase 544 543 ctx neighborhood:543
Rv1980c mpt64 immunogenic protein Mpt64 545 54 textmining:540
Rv2785c rpsO 30S ribosomal protein S15 516 53 textmining:510
Rv1639c hyp hypothetical protein 571 52 textmining:567
Rv3874 esxB ESAT-6-like protein EsxB 445 51 textmining:440
Rv3004 cfp6 low molecular weight protein antigen 6 434 46 textmining:432
Rv2537c aroD 3-dehydroquinate dehydratase 433 46 textmining:431
Rv3419c gcp O-sialoglycoprotein endopeptidase 414 46 textmining:411
Rv3477 PE31 PE family protein PE31 542 41 textmining:542

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: low molecular weight antigen MTB12
  • MTBC0 PGAP product: Low molecular weight antigen MTB12
  • Pfam (hmmscan --cut_ga): Mtb12_C PF26580.1 (E=2e-25)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216892.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Mtb12_C (PF26580.1)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AP6Z
  • Curated reference: UniProt P9WIN7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 12 functional partner(s); context anchor mbtG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002528|Rv2376c|cfp2
MKMVKSIAAGLTAAAAIGAAAAGVTSIMAGGPVVYQMQPVVFGAPLPLDPASAPDVPTAAQLTSLLNSLADPNVSFANKGSLVEGGIGGTEARIADHKLKKAAEHGDLPLSFSVTNIQPAAAGSATADVSVSGPKLSSPVTQNVTFVNQGGWMLSRASAMELLQAAGN