Rv1322 Family assigned · medium auto-curated

H37Rv Rv1322 · MTBC0 mtbc0_001418 · 98 aa · 1495684–1495980 (+) · RefSeq NP_215838.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Contains Rv1322 (PF27609.1) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WM27 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv1322

UniProt still lists this protein as Uncharacterized protein Rv1322; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionATP- GTP-binding protein
Orthologous group2E3EP

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.13% of strains (189) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Rv1322PF27609.1 9.6e-2722–86 Rv1322 family protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: nucS (endonuclease NucS), high confidence from genomic context alone (score 888 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1321 nucS endonuclease NucS 959 888 ctx neighborhood:849 textmining:649
Rv1318c adenylate cyclase 708 709 ctx neighborhood:709
Rv1317c alkA bifunctional regulatory protein/DNA repair enzyme AlkA 648 649 ctx neighborhood:588
Rv1320c adenylate cyclase 580 563 ctx neighborhood:563
Rv1319c adenylate cyclase 527 528 ctx neighborhood:528
Rv3909 hyp hypothetical protein 492 492
Rv1316c ogt methylated-DNA--protein-cysteine methyltransferase 492 491 ctx neighborhood:478
Rv3221A rshA anti-sigma factor RshA 510 487
Rv0736 rslA anti-sigma-L factor RslA 506 483
Rv1222 rseA anti-sigma E factor RseA 499 478
Rv3258c hyp hypothetical protein 465 465 ctx cooccurence:462
Rv0668 rpoC DNA-directed RNA polymerase subunit beta' 487 459 experimental:456
Rv0667 rpoB DNA-directed RNA polymerase subunit beta 484 456 experimental:451
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 466 436 experimental:431
Rv3457c rpoA DNA-directed RNA polymerase subunit alpha 464 435 experimental:431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Pfam (hmmscan --cut_ga): Rv1322 PF27609.1 (E=1e-26)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215838.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rv1322 (PF27609.1)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2E3EP
  • Curated reference: UniProt P9WM27 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor nucS
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001418|Rv1322|
MARRRKPLHRQRPEPPSWALRRVEAGPDGHEYEVRPVAAARAVKTYRCPGCDHEIRSGTAHVVVWPTDLPQAGVDDRRHWHTPCWANRATRGPTRKWT