Rv1928c Family assigned · medium auto-curated

H37Rv Rv1928c · MTBC0 mtbc0_002042 · 255 aa · 2199566–2200333 (-) · RefSeq NP_216444.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)short-chain type dehydrogenase/reductase
MTBC0 PGAP re-annotationSDR family oxidoreductase
Revised (this work)SDR family oxidoreductase. Pfam: adh_short (PF00106.32), KR (PF08659.17), adh_short_C2 (PF13561.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P95286 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable short-chain type dehydrogenase/reductase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Q Secondary metabolites biosynthesis, transport and catabolism
eggNOG descriptionDehydrogenase reductase
Orthologous groupCOG1028
EC number EC 1.1.1.127
KEGG orthology K00065
KEGG pathways map00040

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.479 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 3 frameshift
Disruption 3 distinct premature-stop/frameshift site(s); most common in 9.48% of strains (13769) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
adh_shortPF00106.32 6.0e-5712–206 short chain dehydrogenase
KRPF08659.17 9.6e-1215–166 KR domain
adh_short_C2PF13561.13 6.7e-6718–253 Enoyl-(Acyl carrier protein) reductase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1931c (transcriptional regulator), medium confidence from genomic context alone (score 618 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2524c fas fatty acid synthase 826 800 coexpression:506 experimental:475
Rv1929c hyp hypothetical protein 658 656 ctx neighborhood:645
Rv1930c hyp hypothetical protein 648 647 ctx neighborhood:636
Rv1931c transcriptional regulator 617 618 ctx neighborhood:604
Rv1937 oxygenase 596 548
Rv2299c htpG chaperone protein HtpG 541 521 database:450
Rv0073 glutamine ABC transporter ATP-binding protein 533 512 database:431
Rv2564 glnQ glutamine ABC transporter ATP-binding protein 532 510 database:431
Rv3728 membrane protein 534 508 database:431
Rv3239c transmembrane transport protein 531 506 database:431
Rv2565 NTE family protein 519 500 database:431
Rv2434c transmembrane protein 517 497 database:431
Rv1675c cmr HTH-type transcriptional regulator Cmr 492 491 database:431
Rv0998 acetyltransferase Pat 491 490 database:431
Rv0104 hyp hypothetical protein 490 489 database:431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: short-chain type dehydrogenase/reductase
  • MTBC0 PGAP product: SDR family oxidoreductase
  • Pfam (hmmscan --cut_ga): adh_short PF00106.32 (E=6e-57), KR PF08659.17 (E=1e-11), adh_short_C2 PF13561.13 (E=7e-67)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216444.1)
  • Domains: Pfam-A via hmmscan --cut_ga — adh_short (PF00106.32), KR (PF08659.17), adh_short_C2 (PF13561.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1028
  • Curated reference: UniProt P95286 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 69 functional partner(s); context anchor Rv1931c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002042|Rv1928c|
MSVLDLFDLHGKRALITGASTGIGKRVALAYVEAGAQVAIAARHLDALEKLADEIGTSGGKVVPVCCDVSQHQQVTSMLDQVTAELGGIDIAVCNAGIITVTPMLDMPLEEFQRLQNTNVTGVFLTAQAAAKAMVKQGQGGVIINTASMSGHIINVPQQVSHYCASKAAVIHLTKAMAVELAPHKIRVNSVSPGYILTELVEPYTEYQPLWEPKIPLGRLGRPEELAGLYLYLASEASSYMTGSDIVIDGGYTCP