Rv2776c Resolved · high auto-curated

H37Rv Rv2776c · MTBC0 - · 309 aa · 3083374–3084303 (-) · RefSeq NP_217292.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)oxidoreductase
MTBC0 PGAP re-annotation
Revised (this work)Oxidoreductase. Pfam: NAD_binding_1 (PF00175.27), Fer2 (PF00111.33).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O86347 TrEMBL · unreviewed · Predicted
UniProt nameProbable oxidoreductase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
eggNOG descriptionoxidoreductase
Orthologous groupCOG1018

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.12% of strains (175) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NAD_binding_1PF00175.27 1.1e-04112–202 Oxidoreductase NAD-binding domain
Fer2PF00111.33 3.7e-10234–300 2Fe-2S iron-sulfur cluster binding domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cyp123 (cytochrome P450 Cyp123), high confidence from genomic context alone (score 916 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0766c cyp123 cytochrome P450 Cyp123 920 916 ctx fusion:740
Rv3518c cyp142 cytochrome P450 monooxygenase Cyp142 902 896 ctx fusion:674
Rv2777c hyp hypothetical protein 875 876 ctx neighborhood:741
Rv1465 nitrogen fixation related protein 872 853 database:621
Rv3025c iscS cysteine desulfurase 854 834 experimental:422 database:621
Rv3121 cyp141 cytochrome P450 Cyp141 837 828 ctx fusion:449
Rv1256c cyp130 cytochrome P450 Cyp130 829 819 ctx fusion:514
Rv0778 cyp126 cytochrome P450 Cyp126 803 791
Rv2266 cyp124 cytochrome P450 Cyp124 796 783
Rv1175c fadH NADPH dependent 2,4-dienoyl-CoA reductase FadH 836 776 experimental:430 database:568
Rv0886 fprB ferredoxin/ferredoxin--NADP reductase 866 773 experimental:430 database:568 textmining:436
Rv2268c cyp128 cytochrome P450 Cyp128 770 756
Rv3858c gltD glutamate synthase small subunit 779 753 experimental:430 database:568
Rv3106 fprA NADPH-ferredoxin reductase FprA 778 752 experimental:430 database:568
Rv3153 nuoI NADH-quinone oxidoreductase subunit I 785 751 experimental:700

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): oxidoreductase
  • Pfam (hmmscan --cut_ga): NAD_binding_1 PF00175.27 (E=1e-04), Fer2 PF00111.33 (E=4e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217292.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NAD_binding_1 (PF00175.27), Fer2 (PF00111.33)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1018
  • Curated reference: UniProt O86347 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 97 functional partner(s); context anchor cyp123
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2776c|
MRRTNPAVVTKRELVAPDVVALTLADPGGGLLPAWSPGGHIDVQLPSGRRRQYSLCGVPGRRTDYRIAIRRIADGGGGSIEMHEAFDVGDTCEFEGPRNAFHLGLAERDVLFVIGGIGVTPILPMIRAAEQRGIDWRAIYAGRGREYMPFLDEVVAVAPGRVTVWADDEHGRFASVDELLAGAGPTTAVYVCGPPGMLEAVRVARNQHADAPLHYERFSPPPVVDGVPFELELARSRRVLRVPANRSALDVMLDWDPTTAYSCQQGFCGTCKVRVLAGQVDRRGRIIEGDNEMLVCVSRAVSGRVVIDA