Rv3073c Still unknown · low auto-curated

H37Rv Rv3073c · MTBC0 mtbc0_003267 · 118 aa · 3457693–3458049 (-) · RefSeq NP_217589.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF488 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF488-N3i, DUF488-N3a, DUF488. Function unknown. Foldseek best (non-significant) hit: 3ijd-assembly2_B-2 Uncharacterized protein Cthe_2304 from Clostridium (prob 0.04, TM 0.37).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WL11 SwissProt · reviewed · Predicted
UniProt nameUncharacterized protein Rv3073c

UniProt still lists this protein as Uncharacterized protein Rv3073c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function, DUF488
Orthologous groupCOG3189

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.641 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 4 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.11% of strains (164) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF488-N3iPF22752.2 2.2e-337–116 Inactive DUF488-N3 subclade
DUF488-N3aPF22751.2 6.9e-217–116 Active DUF488-N3 subclade
DUF488PF04343.19 7.5e-279–115 Domain of unknown function DUF488

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 77.8 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
3ijd-assembly2_B-2 0.04 0.37 4.3e+00 3ijd-assembly2_B-2 Uncharacterized protein Cthe_2304 from Clostridium thermocellum binds two copies of 5-methyl-5,6,7,8-tetrahydrofolic acid
3ijd-assembly2_A 0.02 0.35 9.4e+00 3ijd-assembly2_A Uncharacterized protein Cthe_2304 from Clostridium thermocellum binds two copies of 5-methyl-5,6,7,8-tetrahydrofolic acid
7w5r-assembly1_Q 0.01 0.31 1.0e+01 7w5r-assembly1_Q KRAS G12V and peptide complex
4phh-assembly3_C 0.01 0.27 7.2e+00 4phh-assembly3_C Crystal structure of Ypt7 covalently modified with GNP
4phh-assembly1_A 0.01 0.28 8.8e+00 4phh-assembly1_A Crystal structure of Ypt7 covalently modified with GNP

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: udgB (uracil DNA glycosylase), medium confidence from genomic context alone (score 625 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3072c hyp hypothetical protein 818 818 ctx neighborhood:817
Rv1259 udgB uracil DNA glycosylase 625 625 ctx fusion:570
Rv3074 hyp hypothetical protein 599 599 ctx neighborhood:598
Rv3075c hyp hypothetical protein 545 545 ctx neighborhood:544
Rv1347c mbtK lysine N-acetyltransferase MbtK 462 463 ctx neighborhood:461
Rv3100c smpB SsrA-binding protein 426 427

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: DUF488 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF488-N3i PF22752.2 (E=2e-33), DUF488-N3a PF22751.2 (E=7e-21), DUF488 PF04343.19 (E=8e-27)
  • Foldseek best: 3ijd-assembly2_B-2 Uncharacterized protein Cthe_2304 from Clostridium thermocell (prob 0.04, E=4e+00, TM=0.37)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217589.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF488-N3i (PF22752.2), DUF488-N3a (PF22751.2), DUF488 (PF04343.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3189
  • Curated reference: UniProt P9WL11 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 77.8, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 6 functional partner(s); context anchor udgB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003267|Rv3073c|
MVRETRVRVARVYEDIDPDDGQRVLVDRIWPHGIRKDDQRVGIWCKDVAPSKELREWYHHQPERFDEFASRYQEELHDSAALAELRKLTGRSVVTPVTATRHVARSHAAVLAQLLNGR