argD Resolved · high auto-curated

H37Rv Rv1655 · MTBC0 mtbc0_001764 · 400 aa · 1880765–1881967 (+) · RefSeq NP_216171.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)acetylornithine aminotransferase
MTBC0 PGAP re-annotationacetylornithine transaminase
Revised (this work)Acetylornithine transaminase. Pfam: Aminotran_3 (PF00202.28), Aminotran_1_2 (PF00155.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPZ7 SwissProt · reviewed · Evidence at protein level
UniProt nameAcetylornithine aminotransferase
EC (curated) EC 2.6.1.11

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred nameargD
eggNOG descriptionacetylornithine aminotransferase
Orthologous groupCOG4992
EC number EC 2.6.1.11, EC 2.6.1.17
KEGG orthology K00821
KEGG pathways map00220, map00300, map01100, map01110, map01120, map01130, map01210, map01230
KEGG modules M00016, M00028, M00845
Gene Ontology (17) GO:0003674, GO:0005488, GO:0005515, GO:0008144, GO:0008150, GO:0019842, GO:0030170, GO:0036094, GO:0040007, GO:0042802, GO:0043167, GO:0043168 +5 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.512 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Aminotran_3PF00202.28 3.1e-10721–392 Aminotransferase class-III
Aminotran_1_2PF00155.28 4.5e-0462–296 Aminotransferase class I and II

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: argJ (bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1653 argJ bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase 999 1000 ctx neighborhood:881 cooccurence:571 coexpression:948 database:900 textmining:949
Rv1652 argC N-acetyl-gamma-glutamyl-phoshate reductase 999 1000 ctx neighborhood:881 cooccurence:669 coexpression:937 database:900 textmining:925
Rv1654 argB acetylglutamate kinase 999 998 ctx neighborhood:881 cooccurence:659 coexpression:954 textmining:950
Rv1656 argF ornithine carbamoyltransferase 999 997 ctx neighborhood:882 coexpression:948 textmining:868
Rv1658 argG argininosuccinate synthase 997 995 ctx neighborhood:879 coexpression:932 textmining:462
Rv1657 argR arginine repressor 998 988 ctx neighborhood:882 coexpression:905 textmining:915
Rv1659 argH argininosuccinate lyase 995 988 ctx neighborhood:783 coexpression:915 textmining:661
Rv1202 dapE succinyl-diaminopimelate desuccinylase DapE 911 906 database:900
Rv0858c dapC N-succinyldiaminopimelate aminotransferase DapC 909 905 database:900
Rv1201c dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase 911 904 database:900
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 720 623 ctx neighborhood:532
Rv1661 pks7 polyketide synthase 608 570 ctx neighborhood:509
Rv1647 adenylate cyclase 541 542 ctx neighborhood:539
Rv1651c PE_PGRS30 PE-PGRS family protein PE_PGRS30 506 506 ctx neighborhood:501
Rv1699 pyrG CTP synthase 465 466

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: acetylornithine aminotransferase
  • MTBC0 PGAP product: acetylornithine transaminase
  • Pfam (hmmscan --cut_ga): Aminotran_3 PF00202.28 (E=3e-107), Aminotran_1_2 PF00155.28 (E=4e-04)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216171.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Aminotran_3 (PF00202.28), Aminotran_1_2 (PF00155.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4992
  • Curated reference: UniProt P9WPZ7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 34 functional partner(s); context anchor argJ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001764|Rv1655|argD
MTGASTTTATMRQRWQAVMMNNYGTPPIALASGDGAVVTDVDGRTYIDLLGGIAVNVLGHRHPAVIEAVTRQMSTLGHTSNLYATEPGIALAEELVALLGADQRTRVFFCNSGAEANEAAFKLSRLTGRTKLVAAHDAFHGRTMGSLALTGQPAKQTPFAPLPGDVTHVGYGDVDALAAAVDDHTAAVFLEPIMGESGVVVPPAGYLAAARDITARRGALLVLDEVQTGMGRTGAFFAHQHDGITPDVVTLAKGLGGGLPIGACLAVGPAAELLTPGLHGSTFGGNPVCAAAALAVLRVLASDGLVRRAEVLGKSLRHGIEALGHPLIDHVRGRGLLLGIALTAPHAKDAEATARDAGYLVNAAAPDVIRLAPPLIIAEAQLDGFVAALPAILDRAVGAP