Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | arginine deiminase |
| MTBC0 PGAP re-annotation | arginine deiminase |
| Revised (this work) | Arginine deiminase. Pfam: ADI (PF02274.23). |
Auto-curated: this verdict and function were generated by rules from
PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WQ05
SwissProt · reviewed
· Evidence at protein level
|
| UniProt name | Arginine deiminase |
| EC (curated) |
EC 3.5.3.6
|
Functional vocabulary (eggNOG-mapper, orthology transfer)
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are
computed annotations, not manual curation; cross-check against the primary literature
before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS |
0.36 · purifying
|
| Polymorphic sites (≥ 0.1% of strains) |
5 synonymous, 5 missense, 0 nonsense, 0 frameshift
|
pN/pS from segregating SNPs (singletons removed) normalised by possible sites.
Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene).
A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic
variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A
clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a
convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
ADI | PF02274.23 |
7.0e-133 | 35–399 |
Arginine deiminase |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
Rv1656 argF |
ornithine carbamoyltransferase |
987 |
983 |
coexpression:767 database:900 |
Rv1659 argH |
argininosuccinate lyase |
919 |
901 |
database:900 |
Rv1658 argG |
argininosuccinate synthase |
914 |
901 |
database:900 |
Rv2531c |
amino acid decarboxylase |
901 |
806 |
database:800 textmining:513 |
Rv1000c hyp |
hypothetical protein |
679 |
679 ctx |
neighborhood:677 |
Rv2216 |
epimerase family protein |
659 |
660 |
coexpression:660 |
Rv0408 pta |
phosphate acetyltransferase |
751 |
540 |
coexpression:540 textmining:482 |
Rv1155 |
pyridoxine/pyridoxamine 5'-phosphate oxidase |
446 |
446 |
coexpression:446 |
Rv2074 |
pyridoxamine 5'-phosphate oxidase |
443 |
443 |
coexpression:443 |
Rv3369 hyp |
hypothetical protein |
443 |
443 |
coexpression:443 |
Rv2991 hyp |
hypothetical protein |
441 |
442 |
coexpression:442 |
Rv1903 |
membrane protein |
409 |
409 |
coexpression:409 |
Rv2043c pncA |
pyrazinamidase/nicotinamidase PncA |
404 |
404 |
coexpression:404 |
Rv2763c dfrA |
dihydrofolate reductase |
402 |
401 |
coexpression:401 |
Rv0310c hyp |
hypothetical protein |
400 |
401 |
coexpression:401 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression,
experimental, database, text-mining) into a 0–1000 score. The ctx
badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion,
phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an
unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not
depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with
the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: arginine deiminase
- MTBC0 PGAP product: arginine deiminase
- Pfam (hmmscan --cut_ga): ADI PF02274.23 (E=7e-133)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024),
An imputed ancestral reference genome for the MTBC,
doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215517.1)
- Domains: Pfam-A via hmmscan --cut_ga — ADI (PF02274.23)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2235
- Curated reference: UniProt
P9WQ05
(SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of
145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
22 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001076|Rv1001|arcA
MGVELGSNSEVGALRVVILHRPGAELRRLTPRNTDQLLFDGLPWVSRAQDEHDEFAELLASRGAEVLLLSDLLTEALHHSGAARMQGIAAAVDAPRLGLPLAQELSAYLRSLDPGRLAHVLTAGMTFNELPSDTRTDVSLVLRMHHGGDFVIEPLPNLVFTRDSSIWIGPRVVIPSLALRARVREASLTDLIYAHHPRFTGVRRAYESRTAPVEGGDVLLLAPGVVAVGVGERTTPAGAEALARSLFDDDLAHTVLAVPIAQQRAQMHLDTVCTMVDTDTMVMYANVVDTLEAFTIQRTPDGVTIGDAAPFAEAAAKAMGIDKLRVIHTGMDPVVAEREQWDDGNNTLALAPGVVVAYERNVQTNARLQDAGIEVLTIAGSELGTGRGGPRCMSCPAARDPL
Spot an error? Suggest an improvement