metS Resolved · high auto-curated
H37Rv Rv1007c · MTBC0 mtbc0_001082 ·
519 aa ·
1132780–1134339 MTBC0
(-) ·
RefSeq NP_215523.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | methionine--tRNA ligase |
|---|---|
| MTBC0 PGAP re-annotation | methionine--tRNA ligase |
| Revised (this work) | Methionine--tRNA ligase. Pfam: tRNA-synt_1g (PF09334.18), tRNA-synt_1 (PF00133.29), Anticodon_3 (PF19303.6). |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 11 publications
11 TB publications mention this gene. 11 publication(s) discuss this gene (12 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Physical activity intensity and amount are inversely correlated with the risk of tuberculosis in patients with diabetes. doi:10.1038/s41598-025-09593-9 | 2025 |
| Macrophage extracellular traps are induced by Mycoplasma bovis in bovine macrophages through NADPH oxidase/ROS-dependent manner and their antibacterial efficacy. doi:10.1096/fj.202402304R | 2024 |
| The potential association between metabolic disorders and pulmonary tuberculosis: a Mendelian randomization study. doi:10.1186/s40001-024-01845-0 | 2024 |
| Role of phagocyte extracellular traps during Mycobacterium tuberculosis infections and tuberculosis disease processes. doi:10.3389/fmicb.2023.983299 | 2023 |
| Indigenous functional microbial communities for the preferential degradation of chloroacetamide herbicide S-enantiomers in soil. doi:10.1016/j.jhazmat.2021.127135 | 2022 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index -12.60 (95% CI -13.37 to -11.83). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | It is probably essential for cell survival, being required not only for elongation of protein synthesis but also for the initiation of all mRNA translation through initiator tRNA(fMet) aminoacylation [catalytic activity: ATP + L-methionine + tRNA(met) = AMP + diphosphate + L-methionyl-tRNA(met)] |
|---|---|
| Mycobrowser EC |
6.1.1.10
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1034c
· 99.8% identity |
|---|---|
| M. leprae |
ML0238c
· 86.0% identity |
| M. marinum |
MMAR_4481
· 86.9% identity |
| M. smegmatis |
MSMEG_5441
· 75.5% identity |
| M. orygis |
RJtmp_001066
· 99.8% identity |
| M. abscessus |
MAB_1128c
· 69.6% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WFU5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Methionine--tRNA ligase |
| EC (curated) |
EC 6.1.1.10
|
| Curated function | Catalyzes the attachment of L-methionine to tRNA(Met). Is required not only for elongation of protein synthesis but also for the initiation of all mRNA translation through initiator tRNA(fMet) aminoacylation. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | metG |
| eggNOG description | Is required not only for elongation of protein synthesis but also for the initiation of all mRNA translation through initiator tRNA(fMet) aminoacylation |
| Orthologous group | COG0143 |
| EC number |
EC 6.1.1.10
|
| KEGG orthology |
K01874
|
| KEGG pathways |
map00450, map00970
|
| KEGG modules |
M00359, M00360
|
| Gene Ontology (61) |
GO:0003674, GO:0003824, GO:0004812, GO:0004825, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005886, GO:0006082, GO:0006139, GO:0006399 +49 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.27 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 4 missense, 1 nonsense, 0 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.11% of strains (162) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 85.4%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 8/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 62.1% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 31 in the ORF — 31 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.000, mean read count 0. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | metS-FLAG-tetOn-10 (TetON promoter 10) |
|---|---|
| Baseline knockdown fitness | 3.4 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 265.0 ppm · rank 703/3519 (80.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 519 aa |
|---|---|
| Molecular weight | 58.0 kDa |
| Theoretical pI | 5.49 |
| GRAVY | -0.22 (hydrophilic) |
| Aliphatic index | 83.9 |
| Aromaticity | 0.108 |
| Instability index | 34.7 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
tRNA-synt_1g | PF09334.18 | 6.3e-64 | 149–362 | tRNA synthetases class I (M) |
tRNA-synt_1 | PF00133.29 | 1.2e-13 | 222–335 | tRNA synthetases class I (I, L, M and V) |
Anticodon_3 | PF19303.6 | 8.0e-10 | 374–508 | Anticodon binding domain of methionyl tRNA ligase |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
6ax8 |
X-ray diffraction | 2.6 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.9
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6ax8-assembly1_A |
1.00 | 0.99 | 1.1e-78 sig | 6ax8-assembly1_A Mycobacterium tuberculosis methionyl-tRNA synthetase in complex with methionyl-adenylate |
5xet-assembly1_C |
1.00 | 0.99 | 2.5e-77 sig | 5xet-assembly1_C Crystal structure of Mycobacterium tuberculosis methionyl-tRNA synthetase bound by methionyl-adenylate (Met-AMP) |
2x1m-assembly1_A |
1.00 | 0.98 | 6.6e-70 sig | 2x1m-assembly1_A Crystal structure of Mycobacterium smegmatis methionyl-tRNA synthetase in complex with methionine |
5xgq-assembly1_B |
1.00 | 0.95 | 8.4e-71 sig | 5xgq-assembly1_B Crystal structure of apo form (free-state) Mycobacterium tuberculosis methionyl-tRNA synthetase |
5xgq-assembly1_A |
1.00 | 0.95 | 2.8e-70 sig | 5xgq-assembly1_A Crystal structure of apo form (free-state) Mycobacterium tuberculosis methionyl-tRNA synthetase |
Foldseek search of the AlphaFold DB model (mean pLDDT 94.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv1006 (+ strand, 26 bp gap) |
|---|---|
| Downstream (3' on genome) | tatD (+ strand, 85 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
mftR (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: tatD (deoxyribonuclease TatD), high confidence from genomic context alone (score 970 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2992c gltS exp |
glutamate--tRNA ligase | 992 | 972 | experimental:896 database:518 textmining:754 |
Rv0041 leuS exp |
leucine--tRNA ligase | 996 | 970 | coexpression:667 experimental:792 database:571 textmining:875 |
Rv1008 tatD |
deoxyribonuclease TatD | 969 | 970 ctx | neighborhood:783 fusion:723 |
Rv1292 argS exp |
arginine--tRNA ligase | 962 | 947 | experimental:814 database:571 |
Rv1536 ileS exp |
isoleucine--tRNA ligase | 980 | 933 | experimental:784 database:571 textmining:717 |
Rv2124c metH exp |
methionine synthase | 921 | 914 | database:900 |
Rv2845c proS exp |
proline--tRNA ligase | 990 | 907 | coexpression:425 experimental:629 database:571 textmining:900 |
Rv1133c metE exp |
5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase | 905 | 901 | database:900 |
Rv1406 fmt exp |
methionyl-tRNA formyltransferase | 912 | 900 | database:900 |
Rv1640c lysX exp |
bifunctional lysine--tRNA ligase/phosphatidylglycerol lysyltransferase | 880 | 839 | experimental:610 |
Rv3598c lysS exp |
lysine--tRNA ligase | 874 | 825 | experimental:610 |
Rv1650 pheT |
phenylalanine--tRNA ligase subunit beta | 894 | 772 | coexpression:739 textmining:554 |
Rv1009 rpfB |
resuscitation-promoting factor RpfB | 621 | 621 ctx | neighborhood:619 |
Rv2555c alaS |
alanine--tRNA ligase | 670 | 569 | coexpression:470 |
Rv2614c thrS exp |
threonine--tRNA ligase | 931 | 566 | experimental:428 textmining:849 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: methionine--tRNA ligase
- MTBC0 PGAP product: methionine--tRNA ligase
- Pfam (hmmscan --cut_ga): tRNA-synt_1g PF09334.18 (E=6e-64), tRNA-synt_1 PF00133.29 (E=1e-13), Anticodon_3 PF19303.6 (E=8e-10)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215523.1)
- Domains: Pfam-A via hmmscan --cut_ga — tRNA-synt_1g (PF09334.18), tRNA-synt_1 (PF00133.29), Anticodon_3 (PF19303.6)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0143 - Curated reference: UniProt P9WFU5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.9)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
71 functional partner(s); context anchor
tatD - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001082|Rv1007c|metS MKPYYVTTAIAYPNAAPHVGHAYEYIATDAIARFKRLDGYDVRFLTGTDEHGLKVAQAAAAAGVPTAALARRNSDVFQRMQEALNISFDRFIRTTDADHHEASKELWRRMSAAGDIYLDNYSGWYSVRDERFFVESETQLVDGTRLTVETGTPVTWTEEQTYFFRLSAYTDKLLAHYHANPDFIAPETRRNEVISFVSGGLDDLSISRTSFDWGVQVPEHPDHVMYVWVDALTNYLTGAGFPDTDSELFRRYWPADLHMIGKDIIRFHAVYWPAFLMSAGIELPRRIFAHGFLHNRGEKMSKSVGNIVDPVALAEALGVDQVRYFLLREVPFGQDGSYSDEAIVTRINTDLANELGNLAQRSLSMVAKNLDGRVPNPGEFADADAALLATADGLLERVRGHFDAQAMHLALEAIWLMLGDANKYFSVQQPWVLRKSESEADQARFRTTLYVTCEVVRIAALLIQPVMPESAGKILDLLGQAPNQRSFAAVGVRLTPGTALPPPTGVFPRYQPPQPPEGK
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for metS? Email the maintainer — the message is pre-filled with this gene's details.