Rv1000c Family assigned · medium auto-curated

H37Rv Rv1000c · MTBC0 - · 205 aa · 1116531–1117148 (-) · RefSeq YP_177777.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains 2OG-FeII_Oxy_2 (PF13532.13) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L7N6A4 TrEMBL · unreviewed · Predicted
UniProt nameFe2OG dioxygenase domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptionDNA repair protein
Orthologous groupCOG3145

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.26% of strains (376) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
2OG-FeII_Oxy_2PF13532.13 7.5e-16102–200 2OG-Fe(II) oxygenase superfamily

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: arcA (arginine deiminase), medium confidence from genomic context alone (score 679 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2573 2-dehydropantoate 2-reductase 682 682 coexpression:682
Rv1001 arcA arginine deiminase 679 679 ctx neighborhood:677
Rv0976c hyp hypothetical protein 407 407 coexpression:407
Rv1378c hyp hypothetical protein 869 363 textmining:804
Rv1317c alkA bifunctional regulatory protein/DNA repair enzyme AlkA 622 329 textmining:461
Rv3074 hyp hypothetical protein 711 318 textmining:594
Rv1148c hyp hypothetical protein 434 237
Rv1128c hyp hypothetical protein 426 226
Rv1945 hyp hypothetical protein 424 224
Rv2593c ruvA Holliday junction ATP-dependent DNA helicase RuvA 420 210
Rv2594c ruvC crossover junction endodeoxyribonuclease RuvC 675 93 textmining:657
Rv3395c hyp hypothetical protein 813 91 textmining:803
Rv2592c ruvB Holliday junction ATP-dependent DNA helicase RuvB 424 91
Rv2100 hyp hypothetical protein 812 86 textmining:803
Rv2720 lexA repressor LexA 621 83 textmining:605

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): 2OG-FeII_Oxy_2 PF13532.13 (E=7e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177777.1)
  • Domains: Pfam-A via hmmscan --cut_ga — 2OG-FeII_Oxy_2 (PF13532.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3145
  • Curated reference: UniProt L7N6A4 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor arcA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1000c|
MCDKLGGVAIAVQGALFEHNERRQLGDGAFIDIRSGWLTGGEELLDALLSTVPWRAERRQMYDRVVDVPRLVSFHDLTIEDPPHPQLARMRRRLNDIYGGELGEPFTTAGLCYYRDGSDSVAWHGDTIGRGSTEDTMVAIVSLGATRVFALRPRGRGPSLRLPLAHGDLLVMGGSCQRTFEHAVPKTSAPTGPRVSIQFRPRDVR