argH Resolved · high auto-curated

H37Rv Rv1659 · MTBC0 mtbc0_001768 · 470 aa · 1884681–1886093 (+) · RefSeq NP_216175.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)argininosuccinate lyase
MTBC0 PGAP re-annotationargininosuccinate lyase
Revised (this work)Argininosuccinate lyase. Pfam: Lyase_1 (PF00206.26), ASL_C2 (PF14698.12).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPY7 SwissProt · reviewed · Evidence at protein level
UniProt nameArgininosuccinate lyase
EC (curated) EC 4.3.2.1

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred nameargH
eggNOG descriptionargininosuccinate lyase
Orthologous groupCOG0165
EC number EC 4.3.2.1
KEGG orthology K01755
KEGG pathways map00220, map00250, map01100, map01110, map01130, map01230
KEGG modules M00029, M00844, M00845
Gene Ontology (45) GO:0003674, GO:0003824, GO:0004056, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0006082, GO:0006520, GO:0006525, GO:0006526 +33 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.311 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Lyase_1PF00206.26 4.0e-5917–306 Lyase
ASL_C2PF14698.12 1.7e-25369–436 Argininosuccinate lyase C-terminal

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: argG (argininosuccinate synthase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1658 argG argininosuccinate synthase 999 1000 ctx neighborhood:785 cooccurence:768 coexpression:972 database:900 textmining:804
Rv1656 argF ornithine carbamoyltransferase 997 994 ctx neighborhood:783 coexpression:968 textmining:603
Rv1654 argB acetylglutamate kinase 997 988 ctx neighborhood:783 coexpression:929 textmining:767
Rv1655 argD acetylornithine aminotransferase 995 988 ctx neighborhood:783 coexpression:915 textmining:661
Rv1653 argJ bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase 994 983 ctx neighborhood:783 coexpression:894 textmining:679
Rv1657 argR arginine repressor 994 981 ctx neighborhood:783 coexpression:915 textmining:735
Rv1652 argC N-acetyl-gamma-glutamyl-phoshate reductase 996 977 ctx neighborhood:783 coexpression:868 textmining:844
Rv0777 purB adenylosuccinate lyase PurB 956 916 database:900 textmining:510
Rv1001 arcA arginine deiminase 919 901 database:900
Rv1240 mdh malate dehydrogenase 860 851 database:800
Rv1098c fum fumarate hydratase 846 814 database:800
Rv2852c mqo malate:quinone oxidoreductase 829 812 database:800
Rv1131 prpC methylcitrate synthase PrpC 824 808 database:800
Rv0896 gltA2 citrate synthase 1 824 807 database:800
Rv0889c citA citrate synthase 2 824 807 database:800

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: argininosuccinate lyase
  • MTBC0 PGAP product: argininosuccinate lyase
  • Pfam (hmmscan --cut_ga): Lyase_1 PF00206.26 (E=4e-59), ASL_C2 PF14698.12 (E=2e-25)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216175.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Lyase_1 (PF00206.26), ASL_C2 (PF14698.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0165
  • Curated reference: UniProt P9WPY7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 87 functional partner(s); context anchor argG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001768|Rv1659|argH
MSTNEGSLWGGRFAGGPSDALAALSKSTHFDWVLAPYDLTASRAHTMVLFRAGLLTEEQRDGLLAGLDSLAQDVADGSFGPLVTDEDVHAALERGLIDRVGPDLGGRLRAGRSRNDQVAALFRMWLRDAVRRVATGVLDVVGALAEQAAAHPSAIMPGKTHLQSAQPILLAHHLLAHAHPLLRDLDRIVDFDKRAAVSPYGSGALAGSSLGLDPDAIAADLGFSAAADNSVDATAARDFAAEAAFVFAMIAVDLSRLAEDIIVWSSTEFGYVTLHDSWSTGSSIMPQKKNPDIAELARGKSGRLIGNLAGLLATLKAQPLAYNRDLQEDKEPVFDSVAQLELLLPAMAGLVASLTFNVQRMAELAPAGYTLATDLAEWLVRQGVPFRSAHEAAGAAVRAAEQRGVGLQELTDDELAAISPELTPQVREVLTIEGSVSARDCRGGTAPGRVAEQLNAIGEAAERLRRQLVR