Rv2074 Resolved · high auto-curated

H37Rv Rv2074 · MTBC0 mtbc0_002208 · 137 aa · 2359606–2360019 (+) · RefSeq NP_216590.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)pyridoxamine 5'-phosphate oxidase
MTBC0 PGAP re-annotationF420-dependent biliverdin reductase
Revised (this work)F420-dependent biliverdin reductase. Pfam: PNPOx_N (PF01243.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WLL7 SwissProt · reviewed · Evidence at protein level
UniProt nameF420H(2)-dependent biliverdin reductase
EC (curated) EC 1.3.98.-
Curated functionCatalyzes the F420H(2)-dependent reduction of biliverdin-IXalpha at C10 position, leading to bilirubin-IXalpha, a potent antioxidant. As biliverdin-IXalpha is produced in high amounts in macrophages infected with M.tuberculosis, its reduction by Rv2074 may play a role in protecting mycobacteria against oxidative stress, aiding the persistence of M.tuberculosis infection.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionPFAM pyridoxamine 5'-phosphate
Orthologous groupCOG3871
Gene Ontology (30) GO:0003674, GO:0003824, GO:0005488, GO:0005515, GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0008150, GO:0008152, GO:0016491, GO:0016627 +18 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.365 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PNPOx_NPF01243.28 6.0e-1512–128 Pyridoxamine 5'-phosphate oxidase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2073c (oxidoreductase), high confidence from genomic context alone (score 804 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2073c oxidoreductase 803 804 ctx neighborhood:790
Rv2070c cobK precorrin-6A reductase 764 764 ctx neighborhood:731
Rv2071c cobM precorrin-4 C(11)-methyltransferase 732 732 ctx neighborhood:731
Rv2072c cobL precorrin-6Y C(5,15)-methyltransferase 731 731 ctx neighborhood:731
Rv2216 epimerase family protein 515 516 coexpression:512
Rv1156 hyp hypothetical protein 506 506 ctx cooccurence:500
Rv1558 hyp hypothetical protein 487 466 ctx cooccurence:464
Rv1001 arcA arginine deiminase 443 443 coexpression:443
Rv2323c hyp hypothetical protein 416 416 coexpression:414
Rv0052 hyp hypothetical protein 406 407
Rv1015c rplY 50S ribosomal protein L25/general stress protein Ctc 406 406 coexpression:406
Rv2043c pncA pyrazinamidase/nicotinamidase PncA 403 403 coexpression:403

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: pyridoxamine 5'-phosphate oxidase
  • MTBC0 PGAP product: F420-dependent biliverdin reductase
  • Pfam (hmmscan --cut_ga): PNPOx_N PF01243.28 (E=6e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216590.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PNPOx_N (PF01243.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3871
  • Curated reference: UniProt P9WLL7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 12 functional partner(s); context anchor Rv2073c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002208|Rv2074|
MAMVNTTTRLSDDALAFLSERHLAMLTTLRADNSPHVVAVGFTFDPKTHIARVITTGGSQKAVNADRSGLAVLSQVDGARWLSLEGRAAVNSDIDAVRDAELRYAQRYRTPRPNPRRVVIEVQIERVLGSADLLDRA