Rv0979c Still unknown · low auto-curated

H37Rv Rv0979c · MTBC0 mtbc0_001047 · 64 aa · 1102006–1102200 (-) · RefSeq NP_215494.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 4dqz-assembly1_B Crystal Structure of C-terminal Half of Bacterial Hen (prob 0.20, TM 0.53).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53892 TrEMBL · unreviewed · Predicted
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.665 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 38.4 (very low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
4dqz-assembly1_B 0.20 0.53 2.1e+00 4dqz-assembly1_B Crystal Structure of C-terminal Half of Bacterial Hen1
3zxu-assembly1_B 0.16 0.46 1.4e+00 3zxu-assembly1_B Crystal structure of the Ctf19-Mcm21 kinetochore heterodimer from yeast
3zxu-assembly2_D 0.16 0.49 1.4e+00 3zxu-assembly2_D Crystal structure of the Ctf19-Mcm21 kinetochore heterodimer from yeast
4e6n-assembly2_D 0.16 0.45 1.6e+00 4e6n-assembly2_D Crystal structure of bacterial Pnkp-C/Hen1-N heterodimer
4drf-assembly2_D 0.14 0.41 8.9e-01 4drf-assembly2_D Crystal Structure of Bacterial Pnkp-C/Hen1-N Heterodimer
5mu3-assembly1_B 0.10 0.43 2.5e+00 5mu3-assembly1_B Crystal structure of Ctf19-Mcm21 kinetochore assembly bound with Ctf19-Mcm21 binding motif of central kinetochore subunit Okp1
6wd7-assembly1_8 0.09 0.33 1.3e+00 6wd7-assembly1_8 Cryo-EM of elongating ribosome with EF-Tu*GTP elucidates tRNA proofreading (Cognate Structure II-D)
5tz8-assembly1_B 0.08 0.43 4.3e+00 5tz8-assembly1_B Crystal structure of S. aureus TarS

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rpmF (50S ribosomal protein L32), medium confidence from genomic context alone (score 590 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0979A rpmF 50S ribosomal protein L32 919 590 ctx neighborhood:590 textmining:810
Rv0978c PE_PGRS17 PE-PGRS family protein PE_PGRS17 828 405 ctx neighborhood:405 textmining:723
Rv2615c PE_PGRS45 PE-PGRS family protein PE_PGRS45 860 41 textmining:860
Rv0980c PE_PGRS18 PE-PGRS family protein PE_PGRS18 803 41 textmining:803

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 4dqz-assembly1_B Crystal Structure of C-terminal Half of Bacterial Hen1 (prob 0.20, E=2e+00, TM=0.53)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215494.2)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt O53892 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 38.4, very low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 4 functional partner(s); context anchor rpmF
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001047|Rv0979c|
MGFRTQVGAATIASTMTWRIPVEDGPAQFRAGVGPGRDRQFTVVAPMVVGLWDRNRRPGWQWPS