Rv1059 Resolved · high auto-curated

H37Rv Rv1059 · MTBC0 mtbc0_001139 · 354 aa · 1189730–1190794 (+) · RefSeq NP_215575.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationdihydrodipicolinate reductase
Revised (this work)Dihydrodipicolinate reductase. Pfam: DapB_N (PF01113.27), DAP_DH_C (PF19328.5).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53407 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptiondihydrodipicolinate reductase
Orthologous groupCOG3804
EC number EC 1.4.1.12, EC 1.4.1.26
KEGG orthology K21672
KEGG pathways map00310, map00330, map00472

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.174 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.23% of strains (338) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DapB_NPF01113.27 1.3e-0511–75 Dihydrodipicolinate reductase, N-terminus
DAP_DH_CPF19328.5 1.4e-13140–345 2,4-diaminopentanoate dehydrogenase C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadD14 (fatty-acid--CoA ligase FadD14), high confidence from genomic context alone (score 793 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0926c hyp hypothetical protein 925 925 database:900
Rv1905c aao D-amino acid oxidase 900 900 database:900
Rv1062 hyp hypothetical protein 810 810 ctx neighborhood:772
Rv1060 hyp hypothetical protein 809 809 ctx neighborhood:808
Rv1061 hyp hypothetical protein 804 804 ctx neighborhood:772
Rv1058 fadD14 fatty-acid--CoA ligase FadD14 793 793 ctx neighborhood:788
Rv1057 hyp hypothetical protein 630 630 ctx neighborhood:548
Rv0310c hyp hypothetical protein 539 539 ctx cooccurence:537
Rv3519 hyp hypothetical protein 508 509 ctx cooccurence:507
Rv0273c transcriptional regulator 476 477 ctx cooccurence:474
Rv0760c hyp hypothetical protein 475 476 ctx cooccurence:471
Rv2042c hyp hypothetical protein 435 436 ctx cooccurence:432
Rv2015c hyp hypothetical protein 430 430 ctx cooccurence:430
Rv0272c hyp hypothetical protein 425 425 ctx cooccurence:420
Rv3577 hyp hypothetical protein 407 407 ctx cooccurence:404

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: dihydrodipicolinate reductase
  • Pfam (hmmscan --cut_ga): DapB_N PF01113.27 (E=1e-05), DAP_DH_C PF19328.5 (E=1e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215575.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DapB_N (PF01113.27), DAP_DH_C (PF19328.5)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3804
  • Curated reference: UniProt O53407 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor fadD14
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001139|Rv1059|
MTMSLRVIQWATGSVGVAAIKGVLQHPELELVGCWVHSAAKSGKDVGEIIGSPPLGVIATNSIDDVLALDADAVIYAPLLPSVDEVAALLRSGKNVVTPLGWFYPSEKEAAPLEVAAQAGNATLHGAGIGPGAVTELFPLLLSVMSTGVTFVRSEEFSDLRSYGAPDVLRYVMGFGGTPDSALTGPMQKILDGGFLQSVRLCVDRLGFAADPQIRTSQEVAVATAPIDSPIGVIEPGQVAGRRFHWEALVEDTVVVQIAVNWLMGSENLDPPWSFGPAGERYEIEVRGSPDTCVTIKGWQPQTVAAGLKSNPGIVATAAHCVNAIPATCAAPAGIQSFFDLPLITGRAAPGLAR