serC Resolved · high auto-curated

H37Rv Rv0884c · MTBC0 mtbc0_000939 · 376 aa · 984638–985768 (-) · RefSeq NP_215399.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)phosphoserine aminotransferase
MTBC0 PGAP re-annotationphosphoserine transaminase
Revised (this work)Phosphoserine transaminase. Pfam: Aminotran_5 (PF00266.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WQ73 SwissProt · reviewed · Evidence at protein level
UniProt namePhosphoserine aminotransferase
EC (curated) EC 2.6.1.52
Curated functionCatalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred nameserC
eggNOG descriptionCatalyzes the reversible conversion of 3- phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4- phosphonooxybutanoate to phosphohydroxythreonine
Orthologous groupCOG1932
EC number EC 2.6.1.52
KEGG orthology K00831
KEGG pathways map00260, map00680, map00750, map01100, map01120, map01130, map01200, map01230
KEGG modules M00020, M00124
Gene Ontology (59) GO:0001505, GO:0003674, GO:0003824, GO:0004760, GO:0005575, GO:0005576, GO:0005622, GO:0005623, GO:0005737, GO:0005777, GO:0005886, GO:0006082 +47 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.347 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Aminotran_5PF00266.26 2.0e-1442–335 Aminotransferase class-V

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fprB (ferredoxin/ferredoxin--NADP reductase), high confidence from genomic context alone (score 748 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2996c serA1 D-3-phosphoglycerate dehydrogenase 992 979 coexpression:729 database:900 textmining:628
Rv0728c serA2 D-3-phosphoglycerate dehydrogenase SerA 992 977 coexpression:728 database:900 textmining:698
Rv1295 thrC threonine synthase 951 943 database:900
Rv3042c serB2 phosphoserine phosphatase SerB 992 936 database:900 textmining:888
Rv3684 lyase 920 908 database:900
Rv2334 cysK1 O-acetylserine sulfhydrylase 918 907 database:900
Rv0848 cysK2 cysteine synthase CysK 913 906 database:900
Rv0885 hyp hypothetical protein 951 758 ctx neighborhood:756 textmining:807
Rv0883c sepH hyp hypothetical protein 751 752 ctx neighborhood:749
Rv0886 fprB ferredoxin/ferredoxin--NADP reductase 749 748 ctx neighborhood:742
Rv0505c serB1 phosphoserine phosphatase SerB 889 726 database:500 textmining:611
Rv0889c citA citrate synthase 2 740 724 ctx fusion:587
Rv3227 aroA 3-phosphoshikimate 1-carboxyvinyltransferase 733 677 coexpression:650
Rv1307 atpH ATP synthase subunit b/delta 616 616 coexpression:615
Rv1600 hisC1 histidinol-phosphate aminotransferase 583 560 ctx cooccurence:442

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: phosphoserine aminotransferase
  • MTBC0 PGAP product: phosphoserine transaminase
  • Pfam (hmmscan --cut_ga): Aminotran_5 PF00266.26 (E=2e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215399.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Aminotran_5 (PF00266.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1932
  • Curated reference: UniProt P9WQ73 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 89 functional partner(s); context anchor fprB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000939|Rv0884c|serC
MADQLTPHLEIPTAIKPRDGRFGSGPSKVRLEQLQTLTTTAAALFGTSHRQAPVKNLVGRVRSGLAELFSLPDGYEVILGNGGATAFWDAAAFGLIDKRSLHLTYGEFSAKFASAVSKNPFVGEPIIITSDPGSAPEPQTDPSVDVIAWAHNETSTGVAVAVRRPEGSDDALVVIDATSGAGGLPVDIAETDAYYFAPQKNFASDGGLWLAIMSPAALSRIEAIAATGRWVPDFLSLPIAVENSLKNQTYNTPAIATLALLAEQIDWLVGNGGLDWAVKRTADSSQRLYSWAQERPYTTPFVTDPGLRSQVVGTIDFVDDVDAGTVAKILRANGIVDTEPYRKLGRNQLRVAMFPAVEPDDVSALTECVDWVVERL