Rv0882 Still unknown · low auto-curated
H37Rv Rv0882 · MTBC0 mtbc0_000937 ·
94 aa · 983439–983723 (+) ·
RefSeq NP_215397.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transmembrane protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF2537 domain-containing protein |
| Revised (this work) | Conserved hypothetical protein; DUF domain(s) DUF2537. Function unknown. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WKQ9
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Uncharacterized protein Rv0882 |
UniProt still lists this protein as Uncharacterized protein Rv0882; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Protein of unknown function (DUF2537) |
| Orthologous group | 2EVP5 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.178 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 2 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 0.44% of strains (645) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF2537 | PF10801.14 | 4.4e-29 | 10–87 | Protein of unknown function (DUF2537) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0881 (tRNA/rRNA methyltransferase), high confidence from genomic context alone (score 900 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0881 |
tRNA/rRNA methyltransferase | 900 | 900 ctx | neighborhood:882 |
Rv0880 |
HTH-type transcriptional regulator | 883 | 883 ctx | neighborhood:882 |
Rv0879c |
transmembrane protein | 766 | 766 ctx | neighborhood:765 |
Rv0419 lpqM |
lipoprotein peptidase LpqM | 760 | 760 ctx | cooccurence:760 |
Rv2049c hyp |
hypothetical protein | 746 | 747 ctx | cooccurence:745 |
Rv0431 |
tuberculin-like peptide | 733 | 733 ctx | cooccurence:732 |
Rv2743c hyp |
hypothetical protein | 726 | 726 ctx | cooccurence:725 |
Rv2091c |
membrane protein | 721 | 721 ctx | cooccurence:721 |
Rv0556 |
transmembrane protein | 718 | 718 ctx | cooccurence:718 |
Rv0250c hyp |
hypothetical protein | 716 | 717 ctx | cooccurence:715 |
Rv3212 hyp |
hypothetical protein | 701 | 702 ctx | cooccurence:700 |
Rv1486c hyp |
hypothetical protein | 697 | 697 ctx | cooccurence:697 |
Rv0481c hyp |
hypothetical protein | 689 | 690 ctx | cooccurence:689 |
Rv1109c hyp |
hypothetical protein | 684 | 684 ctx | cooccurence:683 |
Rv1166 lpqW |
monoacyl phosphatidylinositol tetramannoside-binding protein LpqW | 683 | 684 ctx | cooccurence:682 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transmembrane protein
- MTBC0 PGAP product: DUF2537 domain-containing protein
- Pfam (hmmscan --cut_ga): DUF2537 PF10801.14 (E=4e-29)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215397.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF2537 (PF10801.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2EVP5 - Curated reference: UniProt P9WKQ9 (SwissProt, reviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
59 functional partner(s); context anchor
Rv0881 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000937|Rv0882| MNDQRDQAVPWATGLAVAGFVAAVIAVAVVVLSLGLIRVHPLLAVGLNIVAVSGLAPTLWGWRRTPVLRWFVLGAAVGVAGAWLALLALTLGDG