Rv0882 Still unknown · low auto-curated

H37Rv Rv0882 · MTBC0 mtbc0_000937 · 94 aa · 983439–983723 (+) · RefSeq NP_215397.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationDUF2537 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF2537. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKQ9 SwissProt · reviewed · Inferred from homology
UniProt nameUncharacterized protein Rv0882

UniProt still lists this protein as Uncharacterized protein Rv0882; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF2537)
Orthologous group2EVP5

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.178 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.44% of strains (645) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF2537PF10801.14 4.4e-2910–87 Protein of unknown function (DUF2537)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0881 (tRNA/rRNA methyltransferase), high confidence from genomic context alone (score 900 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0881 tRNA/rRNA methyltransferase 900 900 ctx neighborhood:882
Rv0880 HTH-type transcriptional regulator 883 883 ctx neighborhood:882
Rv0879c transmembrane protein 766 766 ctx neighborhood:765
Rv0419 lpqM lipoprotein peptidase LpqM 760 760 ctx cooccurence:760
Rv2049c hyp hypothetical protein 746 747 ctx cooccurence:745
Rv0431 tuberculin-like peptide 733 733 ctx cooccurence:732
Rv2743c hyp hypothetical protein 726 726 ctx cooccurence:725
Rv2091c membrane protein 721 721 ctx cooccurence:721
Rv0556 transmembrane protein 718 718 ctx cooccurence:718
Rv0250c hyp hypothetical protein 716 717 ctx cooccurence:715
Rv3212 hyp hypothetical protein 701 702 ctx cooccurence:700
Rv1486c hyp hypothetical protein 697 697 ctx cooccurence:697
Rv0481c hyp hypothetical protein 689 690 ctx cooccurence:689
Rv1109c hyp hypothetical protein 684 684 ctx cooccurence:683
Rv1166 lpqW monoacyl phosphatidylinositol tetramannoside-binding protein LpqW 683 684 ctx cooccurence:682

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: DUF2537 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF2537 PF10801.14 (E=4e-29)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215397.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF2537 (PF10801.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EVP5
  • Curated reference: UniProt P9WKQ9 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 59 functional partner(s); context anchor Rv0881
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000937|Rv0882|
MNDQRDQAVPWATGLAVAGFVAAVIAVAVVVLSLGLIRVHPLLAVGLNIVAVSGLAPTLWGWRRTPVLRWFVLGAAVGVAGAWLALLALTLGDG