Rv0743c Family assigned · low auto-curated
H37Rv Rv0743c · MTBC0 mtbc0_000788 ·
185 aa · 838081–838638 (-) ·
RefSeq NP_215257.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF6036 family nucleotidyltransferase |
| Revised (this work) | DUF6036 family nucleotidyltransferase. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6WZ83
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | DUF6036 domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2DZKR |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.12% of strains (178) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF6036 | PF19502.6 | 1.6e-06 | 20–156 | Nucleotidyltransferase of unknown function (DUF6036) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0744c (transcriptional regulator), high confidence from genomic context alone (score 882 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0744c |
transcriptional regulator | 883 | 882 ctx | neighborhood:882 |
Rv3903c cpnT hyp |
hypothetical protein | 638 | 638 ctx | cooccurence:638 |
Rv0745 hyp |
hypothetical protein | 569 | 569 ctx | neighborhood:490 |
Rv1682 hyp |
hypothetical protein | 510 | 511 ctx | cooccurence:509 |
Rv0749 vapC31 |
ribonuclease VapC31 | 487 | 487 | |
Rv3697c vapC48 |
ribonuclease VapC48 | 479 | 480 ctx | cooccurence:477 |
Rv0659c mazF2 |
toxin MazF2 | 477 | 477 ctx | cooccurence:477 |
Rv0746 PE_PGRS9 |
PE-PGRS family protein PE_PGRS9 | 457 | 456 ctx | neighborhood:456 |
Rv0713 |
transmembrane protein | 451 | 451 ctx | cooccurence:449 |
Rv0538 |
membrane protein | 430 | 431 ctx | cooccurence:430 |
Rv2872 vapC43 |
ribonuclease VapC43 | 414 | 415 ctx | cooccurence:411 |
Rv1648 |
transmembrane protein | 412 | 413 ctx | cooccurence:411 |
Rv1775 hyp |
hypothetical protein | 402 | 403 ctx | cooccurence:401 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: DUF6036 family nucleotidyltransferase
- Pfam (hmmscan --cut_ga): DUF6036 PF19502.6 (E=2e-06)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215257.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF6036 (PF19502.6)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2DZKR - Curated reference: UniProt I6WZ83 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
13 functional partner(s); context anchor
Rv0744c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000788|Rv0743c| MTRQQLAHLLRRACAVVGDVDVLVLGSQSILGSFDENELPPQATASQEADIAFVNDPARDKADHVDVAIGEMSDFHRSNGVYAEGVHIDTAILPNGWRDRLVSWTVESSRPAKPRFLEPHDLAVAKLAAGREKDKAFVAALIRSGLLDVGVIQARVLLLPEETDPRIGQRIAAWLNYYGAGNHSS