Rv0743c Family assigned · low auto-curated

H37Rv Rv0743c · MTBC0 mtbc0_000788 · 185 aa · 838081–838638 (-) · RefSeq NP_215257.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF6036 family nucleotidyltransferase
Revised (this work)DUF6036 family nucleotidyltransferase.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6WZ83 TrEMBL · unreviewed · Evidence at protein level
UniProt nameDUF6036 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2DZKR

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.12% of strains (178) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF6036PF19502.6 1.6e-0620–156 Nucleotidyltransferase of unknown function (DUF6036)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0744c (transcriptional regulator), high confidence from genomic context alone (score 882 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0744c transcriptional regulator 883 882 ctx neighborhood:882
Rv3903c cpnT hyp hypothetical protein 638 638 ctx cooccurence:638
Rv0745 hyp hypothetical protein 569 569 ctx neighborhood:490
Rv1682 hyp hypothetical protein 510 511 ctx cooccurence:509
Rv0749 vapC31 ribonuclease VapC31 487 487
Rv3697c vapC48 ribonuclease VapC48 479 480 ctx cooccurence:477
Rv0659c mazF2 toxin MazF2 477 477 ctx cooccurence:477
Rv0746 PE_PGRS9 PE-PGRS family protein PE_PGRS9 457 456 ctx neighborhood:456
Rv0713 transmembrane protein 451 451 ctx cooccurence:449
Rv0538 membrane protein 430 431 ctx cooccurence:430
Rv2872 vapC43 ribonuclease VapC43 414 415 ctx cooccurence:411
Rv1648 transmembrane protein 412 413 ctx cooccurence:411
Rv1775 hyp hypothetical protein 402 403 ctx cooccurence:401

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: DUF6036 family nucleotidyltransferase
  • Pfam (hmmscan --cut_ga): DUF6036 PF19502.6 (E=2e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215257.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF6036 (PF19502.6)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DZKR
  • Curated reference: UniProt I6WZ83 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor Rv0744c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000788|Rv0743c|
MTRQQLAHLLRRACAVVGDVDVLVLGSQSILGSFDENELPPQATASQEADIAFVNDPARDKADHVDVAIGEMSDFHRSNGVYAEGVHIDTAILPNGWRDRLVSWTVESSRPAKPRFLEPHDLAVAKLAAGREKDKAFVAALIRSGLLDVGVIQARVLLLPEETDPRIGQRIAAWLNYYGAGNHSS