Rv0674 Family assigned · medium auto-curated

H37Rv Rv0674 · MTBC0 mtbc0_000713 · 240 aa · 778150–778872 (+) · RefSeq NP_215188.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationPaaX family transcriptional regulator C-terminal domain-containing protein
Revised (this work)PaaX family transcriptional regulator C-terminal domain-containing protein. Pfam: PaaX (PF07848.19), PaaX_M (PF20803.3), PaaX_C (PF08223.17).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6WZ26 TrEMBL · unreviewed · Predicted
UniProt namePaaX domain-containing protein, C-domain protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionprotein C-terminal domain
Orthologous groupCOG3327
KEGG orthology K02616

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PaaXPF07848.19 2.1e-166–66 PaaX-like protein
PaaX_MPF20803.3 2.8e-0783–135 PaaX protein central Cas2-like domain
PaaX_CPF08223.17 8.6e-07193–230 PaaX-like protein C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: echA4 (enoyl-CoA hydratase EchA4), high confidence from genomic context alone (score 884 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0673 echA4 enoyl-CoA hydratase EchA4 888 884 ctx neighborhood:882
Rv0675 echA5 enoyl-CoA hydratase EchA5 886 882 ctx neighborhood:881
Rv0672 fadE8 acyl-CoA dehydrogenase FadE8 875 876 ctx neighborhood:874
Rv0273c transcriptional regulator 842 843 coexpression:770
Rv3692 moxR2 methanol dehydrogenase transcriptional regulator MoxR 817 817 coexpression:817
Rv3263 DNA methylase 805 805 coexpression:805
Rv3736 AraC/XylS family transcriptional regulator 801 801 coexpression:801
Rv3183 higA3 transcriptional regulator 799 799 coexpression:799
Rv0691c mftR mycofactocin biosynthesis transcriptional regulator MftR 799 799 coexpression:799
Rv1725c hyp hypothetical protein 805 798 coexpression:798
Rv1151c cobB NAD-dependent protein deacylase 798 798 coexpression:798
Rv1773c transcriptional regulator 801 791 coexpression:791
Rv3066 DeoR family transcriptional regulator 788 788 coexpression:788
Rv1453 transcriptional activator protein 785 785 coexpression:785
Rv3328c sigJ ECF RNA polymerase sigma factor SigJ 785 785 coexpression:785

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: PaaX family transcriptional regulator C-terminal domain-containing protein
  • Pfam (hmmscan --cut_ga): PaaX PF07848.19 (E=2e-16), PaaX_M PF20803.3 (E=3e-07), PaaX_C PF08223.17 (E=9e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215188.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PaaX (PF07848.19), PaaX_M (PF20803.3), PaaX_C (PF08223.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3327
  • Curated reference: UniProt I6WZ26 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 58 functional partner(s); context anchor echA4
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000713|Rv0674|
MPAMTARSVVLSVLLGAHPAWATASELIQLTADFGIKETTLRVALTRMVGAGDLVRSADGYRLSDRLLARQRRQDEAMRPRTRAWHGNWHMLIVTSIGTDARTRAALRTCMHHKRFGELREGVWMRPDNLDLDLESDVAARVRMLTARDEAPADLAGQLWDLSGWTEAGHRLLGDMAAATDMPGRFVVAAAMVRHLLTDPMLPAELLPADWPGAGLRAAYHDFATAMAKRRDATQLLEVT