Rv0674 Family assigned · medium auto-curated
H37Rv Rv0674 · MTBC0 mtbc0_000713 ·
240 aa · 778150–778872 (+) ·
RefSeq NP_215188.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | PaaX family transcriptional regulator C-terminal domain-containing protein |
| Revised (this work) | PaaX family transcriptional regulator C-terminal domain-containing protein. Pfam: PaaX (PF07848.19), PaaX_M (PF20803.3), PaaX_C (PF08223.17). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6WZ26
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | PaaX domain-containing protein, C-domain protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| eggNOG description | protein C-terminal domain |
| Orthologous group | COG3327 |
| KEGG orthology |
K02616
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PaaX | PF07848.19 | 2.1e-16 | 6–66 | PaaX-like protein |
PaaX_M | PF20803.3 | 2.8e-07 | 83–135 | PaaX protein central Cas2-like domain |
PaaX_C | PF08223.17 | 8.6e-07 | 193–230 | PaaX-like protein C-terminal domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: echA4 (enoyl-CoA hydratase EchA4), high confidence from genomic context alone (score 884 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0673 echA4 |
enoyl-CoA hydratase EchA4 | 888 | 884 ctx | neighborhood:882 |
Rv0675 echA5 |
enoyl-CoA hydratase EchA5 | 886 | 882 ctx | neighborhood:881 |
Rv0672 fadE8 |
acyl-CoA dehydrogenase FadE8 | 875 | 876 ctx | neighborhood:874 |
Rv0273c |
transcriptional regulator | 842 | 843 | coexpression:770 |
Rv3692 moxR2 |
methanol dehydrogenase transcriptional regulator MoxR | 817 | 817 | coexpression:817 |
Rv3263 |
DNA methylase | 805 | 805 | coexpression:805 |
Rv3736 |
AraC/XylS family transcriptional regulator | 801 | 801 | coexpression:801 |
Rv3183 higA3 |
transcriptional regulator | 799 | 799 | coexpression:799 |
Rv0691c mftR |
mycofactocin biosynthesis transcriptional regulator MftR | 799 | 799 | coexpression:799 |
Rv1725c hyp |
hypothetical protein | 805 | 798 | coexpression:798 |
Rv1151c cobB |
NAD-dependent protein deacylase | 798 | 798 | coexpression:798 |
Rv1773c |
transcriptional regulator | 801 | 791 | coexpression:791 |
Rv3066 |
DeoR family transcriptional regulator | 788 | 788 | coexpression:788 |
Rv1453 |
transcriptional activator protein | 785 | 785 | coexpression:785 |
Rv3328c sigJ |
ECF RNA polymerase sigma factor SigJ | 785 | 785 | coexpression:785 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: PaaX family transcriptional regulator C-terminal domain-containing protein
- Pfam (hmmscan --cut_ga): PaaX PF07848.19 (E=2e-16), PaaX_M PF20803.3 (E=3e-07), PaaX_C PF08223.17 (E=9e-07)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215188.1)
- Domains: Pfam-A via hmmscan --cut_ga — PaaX (PF07848.19), PaaX_M (PF20803.3), PaaX_C (PF08223.17)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3327 - Curated reference: UniProt I6WZ26 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
58 functional partner(s); context anchor
echA4 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000713|Rv0674| MPAMTARSVVLSVLLGAHPAWATASELIQLTADFGIKETTLRVALTRMVGAGDLVRSADGYRLSDRLLARQRRQDEAMRPRTRAWHGNWHMLIVTSIGTDARTRAALRTCMHHKRFGELREGVWMRPDNLDLDLESDVAARVRMLTARDEAPADLAGQLWDLSGWTEAGHRLLGDMAAATDMPGRFVVAAAMVRHLLTDPMLPAELLPADWPGAGLRAAYHDFATAMAKRRDATQLLEVT