mazE8 Resolved · medium auto-curated

H37Rv Rv2274A · MTBC0 - · 82 aa · 2546839–2547087 (-) · RefSeq YP_007410963.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin MazE8
MTBC0 PGAP re-annotation
Revised (this work)Antitoxin MazE8.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P0CL60 SwissProt · reviewed · Inferred from homology
UniProt nameAntitoxin MazE8
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. Its cognate toxin is MazF8.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mazF8 (toxin MazF8), medium confidence from genomic context alone (score 668 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2274c mazF8 toxin MazF8 879 668 ctx neighborhood:668 textmining:653
Rv2276 cyp121 cytochrome P450 Cyp121 572 572 ctx neighborhood:572
Rv2275 cyclo(L-tyrosyl-L-tyrosyl) synthase 572 572 ctx neighborhood:572
Rv0660c mazE2 antitoxin MazE2 870 41 textmining:870
Rv1103c mazE3 antitoxin MazE3 869 41 textmining:869
Rv0456B mazE1 antitoxin MazE1 803 41 textmining:803
Rv2760c vapB42 antitoxin VapB42 657 41 textmining:657
Rv1991A mazE6 antitoxin MazE6 576 41 textmining:576
Rv1991c mazF6 mRNA interferase MazF6 432 41 textmining:432
Rv3384c vapC46 ribonuclease VapC46 431 41 textmining:431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): antitoxin MazE8
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_007410963.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt P0CL60 (SwissProt, reviewed; Inferred from homology)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 10 functional partner(s); context anchor mazF8
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2274A|mazE8
MAEPETLPGRWLPECACLAETVSWEQSRLWSRLLCRPHFRHALPGLTGGSASRPSARSARLVRQPRMTLFSLDHRDGVDARC