mazE8 Resolved · medium auto-curated
H37Rv Rv2274A · MTBC0 - ·
82 aa · 2546839–2547087 (-) ·
RefSeq YP_007410963.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | antitoxin MazE8 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Antitoxin MazE8. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P0CL60
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Antitoxin MazE8 |
| Curated function | Antitoxin component of a type II toxin-antitoxin (TA) system. Its cognate toxin is MazF8. |
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mazF8 (toxin MazF8), medium confidence from genomic context alone (score 668 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2274c mazF8 |
toxin MazF8 | 879 | 668 ctx | neighborhood:668 textmining:653 |
Rv2276 cyp121 |
cytochrome P450 Cyp121 | 572 | 572 ctx | neighborhood:572 |
Rv2275 |
cyclo(L-tyrosyl-L-tyrosyl) synthase | 572 | 572 ctx | neighborhood:572 |
Rv0660c mazE2 |
antitoxin MazE2 | 870 | 41 | textmining:870 |
Rv1103c mazE3 |
antitoxin MazE3 | 869 | 41 | textmining:869 |
Rv0456B mazE1 |
antitoxin MazE1 | 803 | 41 | textmining:803 |
Rv2760c vapB42 |
antitoxin VapB42 | 657 | 41 | textmining:657 |
Rv1991A mazE6 |
antitoxin MazE6 | 576 | 41 | textmining:576 |
Rv1991c mazF6 |
mRNA interferase MazF6 | 432 | 41 | textmining:432 |
Rv3384c vapC46 |
ribonuclease VapC46 | 431 | 41 | textmining:431 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): antitoxin MazE8
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_007410963.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Curated reference: UniProt P0CL60 (SwissProt, reviewed; Inferred from homology)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
10 functional partner(s); context anchor
mazF8 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2274A|mazE8 MAEPETLPGRWLPECACLAETVSWEQSRLWSRLLCRPHFRHALPGLTGGSASRPSARSARLVRQPRMTLFSLDHRDGVDARC