Rv0448c Still unknown · low auto-curated

H37Rv Rv0448c · MTBC0 - · 221 aa · 536504–537169 (-) · RefSeq NP_214962.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF1365. Function unknown. Foldseek best (non-significant) hit: 5n48-assembly2_C Structure of Anticalin N9B in complex with extra-doma (prob 0.04, TM 0.38).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O53733 TrEMBL · unreviewed · Predicted
UniProt nameDUF1365 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF1365)
Orthologous groupCOG3496
KEGG orthology K09701

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF1365PF07103.17 2.8e-602–221 Protein of unknown function (DUF1365)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 92.0 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
5n48-assembly2_C 0.04 0.38 7.1e+00 5n48-assembly2_C Structure of Anticalin N9B in complex with extra-domain B of human oncofetal fibronectin
8gnh-assembly1_B 0.03 0.31 3.8e+00 8gnh-assembly1_B Complex structure of BD-218 and Spike protein
6tav-assembly1_C 0.03 0.18 5.4e-01 6tav-assembly1_C Crystal structure of endopeptidase-induced alpha2-macroglobulin
8ovj-assembly1_Sd 0.02 0.29 5.7e+00 8ovj-assembly1_Sd CRYO-EM STRUCTURE OF LEISHMANIA MAJOR 80S RIBOSOME : PARENTAL STRAIN
7nwt-assembly1_CC 0.02 0.24 4.3e+00 7nwt-assembly1_CC Initiated 70S ribosome in complex with 2A protein from encephalomyocarditis virus (EMCV)
7bny-assembly2_B 0.02 0.23 3.6e+00 7bny-assembly2_B Structure of 2A protein from encephalomyocarditis virus (EMCV)
6gf6-assembly1_B 0.02 0.18 1.5e+00 6gf6-assembly1_B Molecular basis of egg coat filament cross-linking: high-resolution structure of the partially deglycosylated ZP1 ZP-N1 domain homodimer
3w58-assembly2_D 0.01 0.24 6.3e+00 3w58-assembly2_D Crystal structure of Galectin-1 in the lactose-unbound state(P21)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ufaA1 (cyclopropane-fatty-acyl-phospholipid synthase UfaA), high confidence from genomic context alone (score 993 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0447c ufaA1 cyclopropane-fatty-acyl-phospholipid synthase UfaA 993 993 ctx neighborhood:882 fusion:714 cooccurence:750
Rv0449c hyp hypothetical protein 984 982 ctx neighborhood:803 fusion:568 cooccurence:774
Rv0446c transmembrane protein 971 972 ctx neighborhood:882 cooccurence:767
Rv0445c sigK ECF RNA polymerase sigma factor SigK 828 827 ctx neighborhood:726
Rv0444c rskA anti-sigma-K factor RskA 674 673 ctx neighborhood:611
Rv2875 mpt70 major secreted immunogenic protein Mpt70 567 567 coexpression:514
Rv0450c mmpL4 transmembrane transport protein MmpL4 538 538 ctx neighborhood:538
Rv0451c mmpS4 membrane protein MmpS4 509 509 ctx neighborhood:509
Rv3392c cmaA1 cyclopropane mycolic acid synthase CmaA 491 471
Rv3720 fatty acid synthase 472 451
Rv0643c mmaA3 methoxy mycolic acid synthase MmaA3 442 419

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): DUF1365 PF07103.17 (E=3e-60)
  • Foldseek best: 5n48-assembly2_C Structure of Anticalin N9B in complex with extra-domain B of hu (prob 0.04, E=7e+00, TM=0.38)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214962.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF1365 (PF07103.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3496
  • Curated reference: UniProt O53733 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 92.0, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s); context anchor ufaA1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0448c|
MHHSFAYRSYSWYVDVDNLPQLPWWLRPFARFHADDHFADPFSCPPHSSLRDRLDAFFAARGLAVPDGRITALLQARVLGYVFNPLSIFWCHDRDGQLRHVIAEVHNTYGGRHAYLLPPADLPVVTAKNFYVSPFHQLAGYYLIRAPRPDRELDVTVTLHRDRRQVCPEFTATLRGQRRPATTRQIAMMQIISPLAPMVVAARIRIQGIRLWLRRVPVVPR