Rv0345 Family assigned · medium auto-curated
H37Rv Rv0345 · MTBC0 - ·
136 aa · 415050–415460 (+) ·
RefSeq NP_214859.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Contains NTP_transf_3 (PF12804.14) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
O06296
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | MobA-like NTP transferase domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | nboR |
| eggNOG description | MobA-like NTP transferase domain |
| Orthologous group | COG2068 |
| EC number |
EC 1.1.1.328, EC 2.7.7.76
|
| KEGG orthology |
K07141, K19190
|
| KEGG pathways |
map00760, map00790, map01120
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 0.387 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 5.24% of strains (7614) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
NTP_transf_3 | PF12804.14 | 6.3e-13 | 8–114 | MobA-like NTP transferase domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0373c (carbon monoxyde dehydrogenase large subunit), medium confidence from genomic context alone (score 620 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2453c mobA |
molybdenum cofactor guanylyltransferase | 909 | 906 | database:900 |
Rv0994 moeA1 |
molybdopterin molybdenumtransferase 1 | 903 | 904 | database:900 |
Rv0438c moeA2 |
molybdopterin molybdenumtransferase | 903 | 903 | database:900 |
Rv0371c hyp |
hypothetical protein | 900 | 900 | database:900 |
Rv0376c hyp |
hypothetical protein | 870 | 862 ctx | cooccurence:691 coexpression:409 |
Rv0373c |
carbon monoxyde dehydrogenase large subunit | 660 | 620 ctx | neighborhood:544 |
Rv0344c lpqJ |
lipoprotein LpqJ | 594 | 594 ctx | neighborhood:594 |
Rv0372c hyp |
hypothetical protein | 589 | 563 | coexpression:409 |
Rv1230c |
membrane protein | 474 | 474 ctx | cooccurence:448 |
Rv0487 hyp |
hypothetical protein | 464 | 465 ctx | cooccurence:463 |
Rv0375c |
carbon monoxyde dehydrogenase medium subunit | 517 | 461 | |
Rv1226c |
transmembrane protein | 460 | 461 ctx | cooccurence:459 |
Rv2226 hyp |
hypothetical protein | 418 | 418 ctx | cooccurence:418 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Pfam (hmmscan --cut_ga): NTP_transf_3 PF12804.14 (E=6e-13)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214859.1)
- Domains: Pfam-A via hmmscan --cut_ga — NTP_transf_3 (PF12804.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2068 - Curated reference: UniProt O06296 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
13 functional partner(s); context anchor
Rv0373c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0345| MLPSTVVGVLLAAGAGRWYGKPKVLVDGWLDTAVGALRDGGCNDVILVLGAVEVSAPAGVTAITAPDWQQGLSASVRAGLAQADREHADYAVLHVIDTPDVNAKVVARVLGRALVSRSGLAGRGRIPAHSARRRGC