Rv0345 Family assigned · medium auto-curated

H37Rv Rv0345 · MTBC0 - · 136 aa · 415050–415460 (+) · RefSeq NP_214859.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains NTP_transf_3 (PF12804.14) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O06296 TrEMBL · unreviewed · Predicted
UniProt nameMobA-like NTP transferase domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namenboR
eggNOG descriptionMobA-like NTP transferase domain
Orthologous groupCOG2068
EC number EC 1.1.1.328, EC 2.7.7.76
KEGG orthology K07141, K19190
KEGG pathways map00760, map00790, map01120

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.387 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 5.24% of strains (7614) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NTP_transf_3PF12804.14 6.3e-138–114 MobA-like NTP transferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0373c (carbon monoxyde dehydrogenase large subunit), medium confidence from genomic context alone (score 620 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2453c mobA molybdenum cofactor guanylyltransferase 909 906 database:900
Rv0994 moeA1 molybdopterin molybdenumtransferase 1 903 904 database:900
Rv0438c moeA2 molybdopterin molybdenumtransferase 903 903 database:900
Rv0371c hyp hypothetical protein 900 900 database:900
Rv0376c hyp hypothetical protein 870 862 ctx cooccurence:691 coexpression:409
Rv0373c carbon monoxyde dehydrogenase large subunit 660 620 ctx neighborhood:544
Rv0344c lpqJ lipoprotein LpqJ 594 594 ctx neighborhood:594
Rv0372c hyp hypothetical protein 589 563 coexpression:409
Rv1230c membrane protein 474 474 ctx cooccurence:448
Rv0487 hyp hypothetical protein 464 465 ctx cooccurence:463
Rv0375c carbon monoxyde dehydrogenase medium subunit 517 461
Rv1226c transmembrane protein 460 461 ctx cooccurence:459
Rv2226 hyp hypothetical protein 418 418 ctx cooccurence:418

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): NTP_transf_3 PF12804.14 (E=6e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214859.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NTP_transf_3 (PF12804.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2068
  • Curated reference: UniProt O06296 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor Rv0373c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0345|
MLPSTVVGVLLAAGAGRWYGKPKVLVDGWLDTAVGALRDGGCNDVILVLGAVEVSAPAGVTAITAPDWQQGLSASVRAGLAQADREHADYAVLHVIDTPDVNAKVVARVLGRALVSRSGLAGRGRIPAHSARRRGC