Rv3828c Resolved · high auto-curated

H37Rv Rv3828c · MTBC0 - · 203 aa · 4302786–4303397 (-) · RefSeq NP_218345.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)resolvase
MTBC0 PGAP re-annotation
Revised (this work)Resolvase. Pfam: Resolvase (PF00239.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O07795 TrEMBL · unreviewed · Predicted
UniProt namePossible resolvase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptionresolvase
Orthologous groupCOG2452
KEGG orthology K07450

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.45 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 6 missense, 1 nonsense, 2 frameshift
Disruption 3 distinct premature-stop/frameshift site(s); most common in 0.16% of strains (231) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ResolvasePF00239.27 2.4e-1063–188 Resolvase, N terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3827c (transposase), high confidence from genomic context alone (score 978 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3827c transposase 978 978 ctx neighborhood:882 cooccurence:761
Rv2885c transposase 894 891 ctx cooccurence:759 coexpression:553
Rv2978c tnpB transposase 843 839 ctx cooccurence:758
Rv0606 Possible transposase (fragment); Rv0606, (MTCY19H5.16c), len: 247 aa. Possible truncated transposase for IS_1536 element, highly similar to 831 826 ctx cooccurence:757
Rv2791c tnpB transposase 820 815 ctx cooccurence:759
Rv0605 IS1536 family serine type transposase 799 799 coexpression:796
Rv0922 tnpB transposase 791 786 ctx cooccurence:772
Rv3829c dehydrogenase 775 774 ctx neighborhood:773
Rv2979c resolvase 763 763 coexpression:759
Rv3830c TetR family transcriptional regulator 629 629 ctx neighborhood:625
Rv3831 hyp hypothetical protein 460 460 ctx neighborhood:457
Rv2736c recX regulatory protein RecX 446 296
Rv0071 maturase 412 181
Rv3334 MerR family transcriptional regulator 645 47 textmining:643
Rv2956 hyp hypothetical protein 514 47 textmining:511

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): resolvase
  • Pfam (hmmscan --cut_ga): Resolvase PF00239.27 (E=2e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218345.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Resolvase (PF00239.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2452
  • Curated reference: UniProt O07795 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor Rv3827c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3828c|
MSVVCCRNRWMNLAVWAERNGVAWVIAYRWFRAGLLPVPAQRVGRLILVNDPAVEESGRGRTLVYARVSSADQRSDLDRRVARVTAWATSQHLSVDKVVAEGGWALNGHRRKFFALLGDPVVTRIVVEHRDRFCWFGSEYVEAALVAQGRELVVVDLAEVDDDLVGDMTEILTSMCARLYGERAAQNGAKRALAAAVGDAEAA