mmpS1 Family assigned · medium auto-curated
H37Rv Rv0403c · MTBC0 mtbc0_000423 ·
142 aa ·
486592–487020 MTBC0
(-) ·
RefSeq NP_214917.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | membrane protein MmpS1 |
|---|---|
| MTBC0 PGAP re-annotation | MmpS family protein |
| Revised (this work) | MmpS family protein. Pfam: Mycobact_memb (PF05423.19). |
| Functional category (TubercuList) | cell wall and cell processes |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (3 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| In-depth Analysis of IS6110 Genomic Variability in the Mycobacterium tuberculosis Complex. doi:10.3389/fmicb.2022.767912 | 2022 |
| Computational prediction and experimental assessment of secreted/surface proteins from Mycobacterium tuberculosis H37Rv. doi:10.1371/journal.pcbi.1000824 | 2010 |
| Unopposed matrix metalloproteinase-9 expression in human tuberculous granuloma and the role of TNF-alpha-dependent monocyte networks. doi:10.4049/jimmunol.171.10.5579 | 2003 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | mmpL1 (Rv0402c, - strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 0.84 (95% CI -0.44 to 2.90). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0410c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_0705
· 67.6% identity |
| M. smegmatis |
MSMEG_0575
· 47.4% identity |
| M. orygis |
RJtmp_000423
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WJT5
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Probable transport accessory protein MmpS1 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | mmpS1 |
| eggNOG description | Mycobacterium membrane protein |
| Orthologous group | 2BG05 |
| Gene Ontology (2) |
GO:0005575, GO:0005576
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.67 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Mycobacteriaceae
| M. canettii dN/dS (deep-divergence selection) |
0.674 (low power)
· 3 consensus substitution(s) low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 54.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 1/13 non-Mycobacterium reference genomes (down to Mycobacteriaceae) · mean identity 46.5% detected in the sister family Mycobacteriaceae (M. abscessus) but not in the broader Corynebacteriales — a Mycobacteriaceae-restricted gene (single-genome rung: interpret with care) |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 7 in the ORF — 0 in the essential state, 0 growth-defect, 7 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 104.857142857. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 7 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 7 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 8 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 22.5 ppm · rank 2269/3519 (35.5th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (1 TM helix) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 1 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 142 aa |
|---|---|
| Molecular weight | 15.3 kDa |
| Theoretical pI | 6.64 |
| GRAVY | 0.497 (hydrophobic) |
| Aliphatic index | 108.4 |
| Aromaticity | 0.085 |
| Instability index | 17.4 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Mycobact_memb | PF05423.19 | 2.7e-66 | 6–142 | Mycobacterium membrane protein |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 85.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8em5-assembly5_E |
1.00 | 0.98 | 4.1e-11 sig | 8em5-assembly5_E Mycobacterium thermoresistible MmpS5 |
2lw3-assembly1_A |
1.00 | 0.69 | 4.6e-07 sig | 2lw3-assembly1_A Solution structure of the soluble domain of MmpS4 from Mycobacterium tuberculosis |
Foldseek search of the AlphaFold DB model (mean pLDDT 85.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | mmpL1 (- strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | fadD30 (+ strand, 320 bp gap) |
| Predicted operon |
mmpL1 · mmpS1
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: mmpL1 (transmembrane transport protein MmpL1), high confidence from genomic context alone (score 976 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0402c mmpL1 |
transmembrane transport protein MmpL1 | 975 | 976 ctx | neighborhood:881 coexpression:805 |
Rv0404 fadD30 |
long-chain-fatty-acid--AMP ligase FadD30 | 530 | 530 | |
Rv0405 pks6 |
membrane bound polyketide synthase | 405 | 405 | |
Rv1754c hyp |
hypothetical protein | 871 | 53 | textmining:870 |
Rv2336 hyp |
hypothetical protein | 655 | 53 | textmining:651 |
Rv3096 hyp |
hypothetical protein | 548 | 50 | textmining:544 |
Rv3383c idsB |
polyprenyl synthetase IdsB | 525 | 50 | textmining:521 |
Rv0556 |
transmembrane protein | 752 | 47 | textmining:751 |
Rv1682 hyp |
hypothetical protein | 656 | 47 | textmining:654 |
Rv1469 ctpD |
cobalt/nickel-exporting P-type ATPase | 520 | 47 | textmining:517 |
Rv0176 |
Mce associated transmembrane protein | 433 | 47 | textmining:430 |
Rv0835 lpqQ |
lipoprotein LpqQ | 660 | 46 | textmining:659 |
Rv2735c hyp |
hypothetical protein | 660 | 46 | textmining:659 |
Rv3630 |
integral membrane protein | 625 | 46 | textmining:624 |
Rv0264c hyp |
hypothetical protein | 750 | 44 | textmining:750 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: membrane protein MmpS1
- MTBC0 PGAP product: MmpS family protein
- Pfam (hmmscan --cut_ga): Mycobact_memb PF05423.19 (E=3e-66)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214917.1)
- Domains: Pfam-A via hmmscan --cut_ga — Mycobact_memb (PF05423.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2BG05 - Curated reference: UniProt P9WJT5 (SwissProt, reviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 85.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
31 functional partner(s); context anchor
mmpL1 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000423|Rv0403c|mmpS1 MFGVAKRFWIPMVIVIVVAVAAVTVSRLHSVFGSHQHAPDTGNLDPIIAFYPKHVLYEVFGPPGTVASINYLDADAQPHEVVNAAVPWSFTIVTTLTAVVANVVARGDGASLGCRITVNEVIREERIVNAYHAHTSCLVKSA
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for mmpS1? Email the maintainer — the message is pre-filled with this gene's details.