htdX Resolved · high auto-curated

H37Rv Rv0241c · MTBC0 mtbc0_000257 · 280 aa · 290193–291035 (-) · RefSeq NP_214755.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)3-hydroxyacyl-thioester dehydratase HtdX
MTBC0 PGAP re-annotation3-hydroxyacyl-thioester dehydratase HtdX
Revised (this work)3-hydroxyacyl-thioester dehydratase HtdX. Pfam: MaoC_dehydratas (PF01575.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53664 SwissProt · reviewed · Evidence at protein level
UniProt name3-hydroxyacyl-thioester dehydratase X
EC (curated) EC 4.2.1.-, EC 4.2.1.119, EC 4.2.1.55
Curated functionShows trans-enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydratase activity. Displays a broad chain length specificity, with a predilection for the C8 to C12 substrates.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptiondehydratase
Orthologous groupCOG2030

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.549 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 6 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.22% of strains (321) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MaoC_dehydratasPF01575.26 1.1e-26161–271 MaoC like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fabG4 (3-oxoacyl-ACP reductase FabG), high confidence from genomic context alone (score 997 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0242c fabG4 3-oxoacyl-ACP reductase FabG 998 997 ctx neighborhood:879 cooccurence:768 coexpression:853 textmining:449
Rv0243 fadA2 acetyl-CoA acetyltransferase FadA 993 993 ctx neighborhood:772 cooccurence:749 coexpression:878
Rv0860 fadB fatty oxidation protein FadB 737 721
Rv3140 fadE23 acyl-CoA dehydrogenase FadE23 674 674
Rv3139 fadE24 acyl-CoA dehydrogenase 651 651
Rv0672 fadE8 acyl-CoA dehydrogenase FadE8 648 648
Rv3339c icd1 isocitrate dehydrogenase 652 637 database:476
Rv0154c fadE2 acyl-CoA dehydrogenase FadE2 579 578
Rv1043c hyp hypothetical protein 555 555 database:498
Rv3363c hyp hypothetical protein 553 553
Rv0983 pepD serine protease PepD 553 553 database:498
Rv3671c marP serine protease 552 553 database:498
Rv0125 pepA serine protease PepA 551 552 database:498
Rv1223 htrA serine protease HtrA 551 552 database:498
Rv3229c desA3 stearoyl-CoA 9-desaturase 527 526 ctx cooccurence:515

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 3-hydroxyacyl-thioester dehydratase HtdX
  • MTBC0 PGAP product: 3-hydroxyacyl-thioester dehydratase HtdX
  • Pfam (hmmscan --cut_ga): MaoC_dehydratas PF01575.26 (E=1e-26)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214755.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MaoC_dehydratas (PF01575.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2030
  • Curated reference: UniProt O53664 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 129 functional partner(s); context anchor fabG4
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000257|Rv0241c|htdX
MTQPSGLKNLLRAAAGALPVVPRTDQLPNRTVTVEELPIDPANVAAYAAVTGLRYGNQVPLTYPFALTFPSVMSLVTGFDFPFAAMGAIHTENHITQYRPIAVTDAVGVRVRAENLREHRRGLLVDLVTNVSVGNDVAWHQVTTFLHQQRTSLSGEPKPPPQKKPKLPPPAAVLRITPAKIRRYAAVGGDHNPIHTNPIAAKLFGFPTVIAHGMFTAAAVLANIEARFPDAVRYSVRFAKPVLLPATAGLYVAEGDGGWDLTLRNMAKGYPHLTATVRGL