hsp Resolved · high auto-curated
H37Rv Rv0251c · MTBC0 mtbc0_000267 ·
159 aa ·
302555–303034 MTBC0
(-) ·
RefSeq NP_214765.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | heat shock protein |
|---|---|
| MTBC0 PGAP re-annotation | stress-responsive chaperone Acr2 |
| Revised (this work) | Stress-responsive chaperone Acr2. Pfam: HSP20 (PF00011.28). |
| Functional category (TubercuList) | virulence, detoxification, adaptation |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 515 publications
515 TB publications mention this gene. 515 publication(s) discuss this gene (299 in a M. tuberculosis context, 81 in other mycobacteria — M. leprae (22), M. smegmatis (9), M. abscessus (5), M. marinum (5)).
| Publication | Date |
|---|---|
| Henoch-Schoenlein purpura (HSP) like lesions in IL12RB1 and IL12B defects - A multi-centric experience from India. doi:10.1093/cei/uxag035 | 2026 |
| Mycobacterium leprae small heat shock protein-18 complements Lon protease in Escherichia coli. doi:10.1186/s12866-026-04982-0 | 2026 |
| A modified-live Mannheimia haemolytica expressing Mycoplasma bovis EFTu and Hsp70 induced systemic and mucosal antibody responses in American bison but failed to fully protect against Mycoplasma bovis challenge. doi:10.1016/j.vetmic.2025.110680 | 2025 |
| Proteomic Analysis of Drug-Resistant Mycobacterium tuberculosis Clinical Isolates Under Aminoglycoside Drug Pressure. doi:10.1007/s00284-025-04341-8 | 2025 |
| Investigating the Diagnostic and Therapeutic Potential of a T Cell Receptor (TCR)-like single Domain Antibody (sDAb)-Human IgG1 Antibody against Heat Shock Protein (HSP) 16KDa/HLA-A2 for Latent Tuberculosis. doi:10.3390/tropicalmed9070139 | 2024 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
Rv1776c+WhiB4 (Rv1776c and whiB4 ).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 1.10 (95% CI -0.37 to 3.60). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Thought to be involved in the initiation step of translation at high temperature. Bound to 30S ribosomal subunit. Possibly a molecular chaperone. Seems to be regulated positively by SIGE|Rv1221 and negatively by HSPR|Rv0353. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0257c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_0515
· 73.6% identity |
| M. smegmatis |
MSMEG_0424
· 59.9% identity |
| M. orygis |
RJtmp_000267
· 99.4% identity |
| M. abscessus |
MAB_4402
· 54.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O53673
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Heat shock protein Hsp |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
O Post-translational modification, protein turnover, chaperones
|
|---|---|
| Preferred name | hsp |
| eggNOG description | Belongs to the small heat shock protein (HSP20) family |
| Orthologous group | COG0071 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.982 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Mycobacteriaceae
| M. canettii dN/dS (deep-divergence selection) |
0.329 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 69.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 1/13 non-Mycobacterium reference genomes (down to Mycobacteriaceae) · mean identity 54.3% detected in the sister family Mycobacteriaceae (M. abscessus) but not in the broader Corynebacteriales — a Mycobacteriaceae-restricted gene (single-genome rung: interpret with care) |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 6 in the ORF — 0 in the essential state, 0 growth-defect, 6 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 176.333333333. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 6 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 6 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 12 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 933.0 ppm · rank 238/3519 (93.3th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 159 aa |
|---|---|
| Molecular weight | 17.8 kDa |
| Theoretical pI | 5.21 |
| GRAVY | -0.473 (hydrophilic) |
| Aliphatic index | 81.0 |
| Aromaticity | 0.088 |
| Instability index | 38.4 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
HSP20 | PF00011.28 | 3.5e-14 | 47–158 | Hsp20/alpha crystallin family |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 77.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3w1z-assembly1_D |
1.00 | 0.80 | 1.1e-07 sig | 3w1z-assembly1_D Heat shock protein 16.0 from Schizosaccharomyces pombe |
5j7n-assembly1_A |
1.00 | 0.75 | 1.4e-07 sig | 5j7n-assembly1_A Crystal structure of a small heat-shock protein from Xylella fastidiosa reveals a distinct high order structure |
3w1z-assembly1_C |
1.00 | 0.73 | 3.1e-07 sig | 3w1z-assembly1_C Heat shock protein 16.0 from Schizosaccharomyces pombe |
3w1z-assembly1_B |
1.00 | 0.65 | 1.8e-07 sig | 3w1z-assembly1_B Heat shock protein 16.0 from Schizosaccharomyces pombe |
3guf-assembly1_B |
1.00 | 0.74 | 1.3e-06 sig | 3guf-assembly1_B Crystal Structure of the hspA from Xanthomonas axonopodis |
Foldseek search of the AlphaFold DB model (mean pLDDT 77.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv0250c (- strand, 144 bp gap) |
|---|---|
| Downstream (3' on genome) | nirB (+ strand, 213 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
phoP (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: nirD (nitrite reductase small subunit NirD), medium confidence from genomic context alone (score 585 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0384c clpB |
chaperone protein ClpB | 898 | 771 | coexpression:727 textmining:576 |
Rv3596c clpC1 |
ATP-dependent protease ATP-binding subunit ClpC | 771 | 705 | coexpression:649 |
Rv2667 clpC2 |
ATP-dependent protease ATP-binding subunit ClpC | 750 | 702 | coexpression:645 |
Rv0253 nirD |
nitrite reductase small subunit NirD | 587 | 585 ctx | neighborhood:585 |
Rv2299c htpG |
chaperone protein HtpG | 611 | 560 | coexpression:494 |
Rv2053c fxsA |
transmembrane protein FxsA | 550 | 551 | coexpression:551 |
Rv0250c hyp |
hypothetical protein | 619 | 550 ctx | neighborhood:543 |
Rv0350 dnaK |
chaperone protein DnaK | 789 | 526 | coexpression:446 textmining:573 |
Rv2264c hyp |
hypothetical protein | 534 | 505 | coexpression:422 |
Rv3446c hyp |
hypothetical protein | 531 | 502 | coexpression:418 |
Rv0312 hyp |
hypothetical protein | 531 | 502 | coexpression:418 |
Rv2004c hyp |
hypothetical protein | 501 | 501 | |
Rv0252 nirB |
nitrite reductase large subunit NirB | 501 | 501 ctx | neighborhood:501 |
Rv0351 grpE |
stress response protein GrpE | 710 | 498 | coexpression:469 textmining:447 |
Rv2744c 35kd_ag hyp |
hypothetical protein | 539 | 495 | coexpression:494 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: heat shock protein
- MTBC0 PGAP product: stress-responsive chaperone Acr2
- Pfam (hmmscan --cut_ga): HSP20 PF00011.28 (E=4e-14)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214765.1)
- Domains: Pfam-A via hmmscan --cut_ga — HSP20 (PF00011.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0071 - Curated reference: UniProt O53673 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 77.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
38 functional partner(s); context anchor
nirD - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000267|Rv0251c|hsp MNNLALWSRPVWDVEPWDRWLRDFFGPAATTDWYRPVAGDFTPAAEIVKDGDDAVVRLELPGIDVDKDVNVELDPGQPVSRLVIRGEHRDEHTQDAGDKDGRTLREIRYGSFRRSFRLPAHVTSEAIAASYDAGVLTVRVAGAYKAPAETQAQRIAITK
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for hsp? Email the maintainer — the message is pre-filled with this gene's details.