hsp Resolved · high auto-curated
H37Rv Rv0251c · MTBC0 mtbc0_000267 ·
159 aa · 302555–303034 (-) ·
RefSeq NP_214765.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | heat shock protein |
|---|---|
| MTBC0 PGAP re-annotation | stress-responsive chaperone Acr2 |
| Revised (this work) | Stress-responsive chaperone Acr2. Pfam: HSP20 (PF00011.28). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53673
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Heat shock protein Hsp |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
O Post-translational modification, protein turnover, chaperones
|
|---|---|
| Preferred name | hsp |
| eggNOG description | Belongs to the small heat shock protein (HSP20) family |
| Orthologous group | COG0071 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.982 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
HSP20 | PF00011.28 | 3.5e-14 | 47–158 | Hsp20/alpha crystallin family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: nirD (nitrite reductase small subunit NirD), medium confidence from genomic context alone (score 585 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0384c clpB |
chaperone protein ClpB | 898 | 771 | coexpression:727 textmining:576 |
Rv3596c clpC1 |
ATP-dependent protease ATP-binding subunit ClpC | 771 | 705 | coexpression:649 |
Rv2667 clpC2 |
ATP-dependent protease ATP-binding subunit ClpC | 750 | 702 | coexpression:645 |
Rv0253 nirD |
nitrite reductase small subunit NirD | 587 | 585 ctx | neighborhood:585 |
Rv2299c htpG |
chaperone protein HtpG | 611 | 560 | coexpression:494 |
Rv2053c fxsA |
transmembrane protein FxsA | 550 | 551 | coexpression:551 |
Rv0250c hyp |
hypothetical protein | 619 | 550 ctx | neighborhood:543 |
Rv0350 dnaK |
chaperone protein DnaK | 789 | 526 | coexpression:446 textmining:573 |
Rv2264c hyp |
hypothetical protein | 534 | 505 | coexpression:422 |
Rv3446c hyp |
hypothetical protein | 531 | 502 | coexpression:418 |
Rv0312 hyp |
hypothetical protein | 531 | 502 | coexpression:418 |
Rv2004c hyp |
hypothetical protein | 501 | 501 | |
Rv0252 nirB |
nitrite reductase large subunit NirB | 501 | 501 ctx | neighborhood:501 |
Rv0351 grpE |
stress response protein GrpE | 710 | 498 | coexpression:469 textmining:447 |
Rv2744c 35kd_ag hyp |
hypothetical protein | 539 | 495 | coexpression:494 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: heat shock protein
- MTBC0 PGAP product: stress-responsive chaperone Acr2
- Pfam (hmmscan --cut_ga): HSP20 PF00011.28 (E=4e-14)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214765.1)
- Domains: Pfam-A via hmmscan --cut_ga — HSP20 (PF00011.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0071 - Curated reference: UniProt O53673 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
38 functional partner(s); context anchor
nirD - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000267|Rv0251c|hsp MNNLALWSRPVWDVEPWDRWLRDFFGPAATTDWYRPVAGDFTPAAEIVKDGDDAVVRLELPGIDVDKDVNVELDPGQPVSRLVIRGEHRDEHTQDAGDKDGRTLREIRYGSFRRSFRLPAHVTSEAIAASYDAGVLTVRVAGAYKAPAETQAQRIAITK