Rv0232 Family assigned · medium auto-curated

H37Rv Rv0232 · MTBC0 mtbc0_000247 · 229 aa · 278280–278969 (+) · RefSeq NP_214746.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator
MTBC0 PGAP re-annotationTetR/AcrR family transcriptional regulator
Revised (this work)TetR/AcrR family transcriptional regulator. Pfam: TetR_N (PF00440.30).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P96415 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable transcriptional regulatory protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptiontetR family
Orthologous groupCOG1309

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TetR_NPF00440.30 3.7e-1218–60 Bacterial regulatory proteins, tetR family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: nrdB (ribonucleoside-diphosphate reductase subunit beta NrdB), high confidence from genomic context alone (score 983 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0233 nrdB ribonucleoside-diphosphate reductase subunit beta NrdB 982 983 ctx neighborhood:882 coexpression:860
Rv0231 fadE4 acyl-CoA dehydrogenase FadE4 757 758 ctx neighborhood:756
Rv0230c php phosphotriesterase 749 749 ctx neighborhood:697
Rv3830c TetR family transcriptional regulator 566 553 ctx cooccurence:549
Rv1354c hyp hypothetical protein 519 476 ctx cooccurence:407
Rv3829c dehydrogenase 469 469 ctx cooccurence:466
Rv0048c membrane protein 461 461 ctx cooccurence:461
Rv3773c hyp hypothetical protein 453 454 ctx cooccurence:446
Rv0128 transmembrane protein 449 449 ctx cooccurence:449
Rv1061 hyp hypothetical protein 429 429 ctx cooccurence:426
Rv0875c hyp hypothetical protein 427 427 ctx cooccurence:419
Rv1171 hyp hypothetical protein 426 427 ctx cooccurence:410
Rv0736 rslA anti-sigma-L factor RslA 425 426 ctx cooccurence:418
Rv1014c pth peptidyl-tRNA hydrolase 403 403 coexpression:401
Rv2434c transmembrane protein 418 397

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transcriptional regulator
  • MTBC0 PGAP product: TetR/AcrR family transcriptional regulator
  • Pfam (hmmscan --cut_ga): TetR_N PF00440.30 (E=4e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214746.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TetR_N (PF00440.30)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1309
  • Curated reference: UniProt P96415 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 25 functional partner(s); context anchor nrdB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000247|Rv0232|
MPTVTWARVDPARRAAVVEAAEAEFGAHGFSRGSLNVIARRAGVAKGSLFQYFADKRDLYAFIADIASQRVRSYMEDLIRELDPNRPFFEFLTDLLDGWVAYFAEHPRERALHAAATLEVDTDARISVRSVLHRHYLDVLRPLVRDAHARGDLRADSDTGALMSLLLLIFPHLALAPYMRGLDPILGLDEPTPEQPALAVRRLVAVLAAAFDAQHPATNSAQTRSEEIT