fadA2 Resolved · high auto-curated
H37Rv Rv0243 · MTBC0 mtbc0_000259 ·
440 aa · 292552–293874 (+) ·
RefSeq NP_214757.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | acetyl-CoA acetyltransferase FadA |
|---|---|
| MTBC0 PGAP re-annotation | acetyl-CoA C-acetyltransferase |
| Revised (this work) | Acetyl-CoA C-acetyltransferase. Pfam: Thiolase_N (PF00108.30), Thiolase_C (PF02803.25). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O86361
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable acetyl-CoA acyltransferase FadA2 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| Preferred name | fadA2 |
| eggNOG description | Catalyzes the synthesis of acetoacetyl coenzyme A from two molecules of acetyl coenzyme A. It can also act as a thiolase, catalyzing the reverse reaction and generating two-carbon units from the four-carbon product of fatty acid oxidation |
| Orthologous group | COG0183 |
| EC number |
EC 2.3.1.9
|
| KEGG orthology |
K00626
|
| KEGG pathways |
map00071, map00072, map00280, map00310, map00362, map00380, map00620, map00630, map00640, map00650, map00720, map00900, map01100, map01110, map01120, map01130, map01200, map01212, map02020
|
| KEGG modules |
M00088, M00095, M00373, M00374, M00375
|
| Gene Ontology (71) |
GO:0003674, GO:0003676, GO:0003723, GO:0003729, GO:0003824, GO:0003988, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005739 +59 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 6 missense, 0 nonsense, 2 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 0.13% of strains (193) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Thiolase_N | PF00108.30 | 1.4e-41 | 15–283 | Thiolase, N-terminal domain |
Thiolase_C | PF02803.25 | 4.4e-27 | 291–439 | Thiolase, C-terminal domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: htdX (3-hydroxyacyl-thioester dehydratase HtdX), high confidence from genomic context alone (score 993 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0860 fadB |
fatty oxidation protein FadB | 998 | 998 | coexpression:697 experimental:804 database:942 |
Rv0241c htdX |
3-hydroxyacyl-thioester dehydratase HtdX | 993 | 993 ctx | neighborhood:772 cooccurence:749 coexpression:878 |
Rv0242c fabG4 |
3-oxoacyl-ACP reductase FabG | 992 | 992 ctx | neighborhood:773 cooccurence:740 coexpression:863 |
Rv1715 fadB3 |
3-hydroxybutyryl-CoA dehydrogenase FadB | 975 | 974 | coexpression:432 experimental:412 database:900 |
Rv0468 fadB2 |
3-hydroxybutyryl-CoA dehydrogenase | 973 | 972 | coexpression:425 experimental:412 database:900 |
Rv3667 acs |
acetyl-CoAsynthetase | 943 | 941 | coexpression:413 database:900 |
Rv1837c glcB |
malate synthase | 928 | 925 | database:900 |
Rv3710 leuA |
2-isopropylmalate synthase | 926 | 924 | database:900 |
Rv0859 fadA |
acyltransferase | 924 | 924 | database:900 |
Rv3556c fadA6 |
acetyl-CoA acetyltransferase FadA | 924 | 924 | database:900 |
Rv1323 fadA4 |
acetyl-CoA acetyltransferase | 923 | 923 | database:900 |
Rv1074c fadA3 |
beta-ketoacyl CoA thiolase FadA | 923 | 923 | database:900 |
Rv2503c scoB |
succinyl-CoA:3-ketoacid-CoA transferase subunit B | 926 | 922 | database:900 |
Rv3546 fadA5 |
acetyl-CoA acetyltransferase FadA | 925 | 922 | database:900 |
Rv2504c scoA |
succinyl-CoA:3-ketoacid-CoA transferase subunit A | 924 | 920 | database:900 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: acetyl-CoA acetyltransferase FadA
- MTBC0 PGAP product: acetyl-CoA C-acetyltransferase
- Pfam (hmmscan --cut_ga): Thiolase_N PF00108.30 (E=1e-41), Thiolase_C PF02803.25 (E=4e-27)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214757.1)
- Domains: Pfam-A via hmmscan --cut_ga — Thiolase_N (PF00108.30), Thiolase_C (PF02803.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0183 - Curated reference: UniProt O86361 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
136 functional partner(s); context anchor
htdX - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000259|Rv0243|fadA2 MAPAAKNTSQTRRRVAVLGGNRIPFARSDGAYADASNQDMFTAALSGLVDRFGLAGERLDMVVGGAVLKHSRDFNLMRECVLGSELSPYTPAFDLQQACGTGLQAAIAAADGIAAGRYEVAAAGGVDTTSDPPIGLGDDLRRTLLKLRRSRSNVQRLKLVGTLPASLGVEIPANSEPRTGLSMGEHAAVTAKQMGIKRVDQDELAAASHRNMADAYDRGFFDDLVSPFLGLYRDDNLRPNSSVEKLATLRPVFGVKAGDATMTAGNSTPLTDGASVALLASEQWAEAHSLAPLAYLVDAETAAVDYVNGNDGLLMAPTYAVPRLLARNGLSLQDFDFYEIHEAFASVVLAHLAAWESEEYCKRRLGLDAALGSIDRSKLNVNGSSLAAGHPFAATGGRILAQTAKQLAEKKAAKKGGGPLRGLISICAAGGQGVAAILEA