fadA2 Resolved · high auto-curated

H37Rv Rv0243 · MTBC0 mtbc0_000259 · 440 aa · 292552–293874 (+) · RefSeq NP_214757.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)acetyl-CoA acetyltransferase FadA
MTBC0 PGAP re-annotationacetyl-CoA C-acetyltransferase
Revised (this work)Acetyl-CoA C-acetyltransferase. Pfam: Thiolase_N (PF00108.30), Thiolase_C (PF02803.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O86361 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable acetyl-CoA acyltransferase FadA2

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred namefadA2
eggNOG descriptionCatalyzes the synthesis of acetoacetyl coenzyme A from two molecules of acetyl coenzyme A. It can also act as a thiolase, catalyzing the reverse reaction and generating two-carbon units from the four-carbon product of fatty acid oxidation
Orthologous groupCOG0183
EC number EC 2.3.1.9
KEGG orthology K00626
KEGG pathways map00071, map00072, map00280, map00310, map00362, map00380, map00620, map00630, map00640, map00650, map00720, map00900, map01100, map01110, map01120, map01130, map01200, map01212, map02020
KEGG modules M00088, M00095, M00373, M00374, M00375
Gene Ontology (71) GO:0003674, GO:0003676, GO:0003723, GO:0003729, GO:0003824, GO:0003988, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005739 +59 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 6 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.13% of strains (193) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Thiolase_NPF00108.30 1.4e-4115–283 Thiolase, N-terminal domain
Thiolase_CPF02803.25 4.4e-27291–439 Thiolase, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: htdX (3-hydroxyacyl-thioester dehydratase HtdX), high confidence from genomic context alone (score 993 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0860 fadB fatty oxidation protein FadB 998 998 coexpression:697 experimental:804 database:942
Rv0241c htdX 3-hydroxyacyl-thioester dehydratase HtdX 993 993 ctx neighborhood:772 cooccurence:749 coexpression:878
Rv0242c fabG4 3-oxoacyl-ACP reductase FabG 992 992 ctx neighborhood:773 cooccurence:740 coexpression:863
Rv1715 fadB3 3-hydroxybutyryl-CoA dehydrogenase FadB 975 974 coexpression:432 experimental:412 database:900
Rv0468 fadB2 3-hydroxybutyryl-CoA dehydrogenase 973 972 coexpression:425 experimental:412 database:900
Rv3667 acs acetyl-CoAsynthetase 943 941 coexpression:413 database:900
Rv1837c glcB malate synthase 928 925 database:900
Rv3710 leuA 2-isopropylmalate synthase 926 924 database:900
Rv0859 fadA acyltransferase 924 924 database:900
Rv3556c fadA6 acetyl-CoA acetyltransferase FadA 924 924 database:900
Rv1323 fadA4 acetyl-CoA acetyltransferase 923 923 database:900
Rv1074c fadA3 beta-ketoacyl CoA thiolase FadA 923 923 database:900
Rv2503c scoB succinyl-CoA:3-ketoacid-CoA transferase subunit B 926 922 database:900
Rv3546 fadA5 acetyl-CoA acetyltransferase FadA 925 922 database:900
Rv2504c scoA succinyl-CoA:3-ketoacid-CoA transferase subunit A 924 920 database:900

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: acetyl-CoA acetyltransferase FadA
  • MTBC0 PGAP product: acetyl-CoA C-acetyltransferase
  • Pfam (hmmscan --cut_ga): Thiolase_N PF00108.30 (E=1e-41), Thiolase_C PF02803.25 (E=4e-27)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214757.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Thiolase_N (PF00108.30), Thiolase_C (PF02803.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0183
  • Curated reference: UniProt O86361 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 136 functional partner(s); context anchor htdX
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000259|Rv0243|fadA2
MAPAAKNTSQTRRRVAVLGGNRIPFARSDGAYADASNQDMFTAALSGLVDRFGLAGERLDMVVGGAVLKHSRDFNLMRECVLGSELSPYTPAFDLQQACGTGLQAAIAAADGIAAGRYEVAAAGGVDTTSDPPIGLGDDLRRTLLKLRRSRSNVQRLKLVGTLPASLGVEIPANSEPRTGLSMGEHAAVTAKQMGIKRVDQDELAAASHRNMADAYDRGFFDDLVSPFLGLYRDDNLRPNSSVEKLATLRPVFGVKAGDATMTAGNSTPLTDGASVALLASEQWAEAHSLAPLAYLVDAETAAVDYVNGNDGLLMAPTYAVPRLLARNGLSLQDFDFYEIHEAFASVVLAHLAAWESEEYCKRRLGLDAALGSIDRSKLNVNGSSLAAGHPFAATGGRILAQTAKQLAEKKAAKKGGGPLRGLISICAAGGQGVAAILEA