Rv0074 Family assigned · medium

H37Rv Rv0074 · MTBC0 mtbc0_000082 · 411 aa · 82911–84146 (+) · RefSeq NP_214588.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationamidohydrolase family protein
Revised (this work)Amidohydrolase-superfamily metalloenzyme (Pfam Amidohydro_1 PF01979 + Amidohydro_3). A TIM-barrel metal-dependent hydrolase; the specific substrate in M. tuberculosis is not established.

Curated reference (UniProt)

UniProt O53619 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
eggNOG descriptionamidohydrolase
Orthologous groupCOG1228

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.311 · purifying
Polymorphic sites (≥ 0.1% of strains) 8 synonymous, 7 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 17.64% of strains (25616) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Amidohydro_1PF01979.27 1.1e-5765–396 Amidohydrolase family
Amidohydro_3PF07969.18 1.7e-1699–398 Amidohydrolase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0075 (aminotransferase), high confidence from genomic context alone (score 934 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0075 aminotransferase 934 934 ctx neighborhood:777 coexpression:716
Rv0073 glutamine ABC transporter ATP-binding protein 676 664 ctx neighborhood:605
Rv0072 glutamine ABC transporter permease 627 627 ctx neighborhood:605
Rv0552 hyp hypothetical protein 572 572 ctx cooccurence:570
Rv2052c hyp hypothetical protein 511 511 ctx cooccurence:503
Rv1922 lipoprotein 450 451 ctx cooccurence:450
Rv2216 epimerase family protein 437 437 coexpression:405
Rv3306c amiB1 amidase AmiB 438 416
Rv2947c pks15 polyketide synthase 489 67 textmining:475
Rv0071 maturase 870 47 textmining:870
Rv2352c PPE38 PPE family protein PPE38 551 46 textmining:549
Rv3346c transmembrane protein 805 45 textmining:805
Rv2628 hyp hypothetical protein 653 44 textmining:652
Rv2623 TB31.7 universal stress protein 428 44 textmining:427

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: 'amidohydrolase family protein'
  • Pfam: Amidohydro_1 PF01979 (E=1.1e-57), Amidohydro_3 PF07969 (E=1.7e-16)

ESM Atlas signal (exploratory)

Ancestral protein hash 611e052a07eda841fe07d051ebf1c198 · 10 ESM-space neighbours (max similarity 0.863). SAE features are orienting indices, not validated domains.

#IndexActivationInterpretation
110492 1.39 Metalloenzyme active-site helix
27206 1.17 Metal-proximal gating segment
312199 1.14 Metal-dependent hydrolase metallocenter
45844 1.14 Generalized metal-binding motif
511701 1.13 N-terminal metal-binding scaffold
68911 1.11 C-terminal active-site flanks
73152 1.10 Metallo-amidohydrolase C-terminal cap
84689 1.07 Amido/urease acidic Gly-rich cap loop

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214588.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Amidohydro_1 (PF01979.27), Amidohydro_3 (PF07969.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1228
  • Curated reference: UniProt O53619 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor Rv0075
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000082|Rv0074|
MGDLSISQVSARPGRIGIRARQMFDGYRFQRGPVLVVVEDGRISAVDFAGSACPDMNLVDLGESTLLPGLVDAHAHLCWDPDGRPEDLAGDPHAVLVGRARRHAAAALRSGITTIRDLGDRDYAALALREEYRQKTTVGPELVVSGPPLTRSGGHCWFLGGVADSVEELVDAVQERAARGADWIKVMATGGFVTTASDPWQPQYGSGQLAAVVAAAEQVGLPVTAHAHATAGIAAAVAAGVDGIEHCTFLSEGSAAASPDVVEAIVAQGVWCGMTIPRVYPEMPENLVAVVQDGWRNIRRLIDAGARVALSTDAGVAPGRRHDVLPDDLVYLSRHGFTSTEVLTGATAAAAASCGLGHRKGRIAPGYDADLLAVAAGVDHDPAGLCDVKAVWRSGTQVPLQASAVGYNTPS