rnpA Resolved · high auto-curated

H37Rv Rv3923c · MTBC0 - · 125 aa · 4410412–4410789 (-) · RefSeq NP_218440.3

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ribonuclease P protein component
MTBC0 PGAP re-annotation
Revised (this work)Ribonuclease P protein component. Pfam: Ribonuclease_P (PF00825.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WGZ3 SwissProt · reviewed · Evidence at protein level
UniProt nameRibonuclease P protein component
EC (curated) EC 3.1.26.5
Curated functionRNaseP catalyzes the removal of the 5'-leader sequence from pre-tRNA to produce the mature 5'-terminus. It can also cleave other RNA substrates such as 4.5S RNA. The protein component plays an auxiliary but essential role in vivo by binding to the 5'-leader sequence and broadening the substrate specificity of the ribozyme.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namernpA
eggNOG descriptionRNaseP catalyzes the removal of the 5'-leader sequence from pre-tRNA to produce the mature 5'-terminus. It can also cleave other RNA substrates such as 4.5S RNA. The protein component plays an auxiliary but essential role in vivo by binding to the 5'-leader sequence and broadening the substrate specificity of the ribozyme
Orthologous groupCOG0594
EC number EC 3.1.26.5
KEGG orthology K03536
Gene Ontology (2) GO:0008150, GO:0040007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.739 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribonuclease_PPF00825.25 8.5e-2212–117 Ribonuclease P

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: yidD (membrane protein insertion efficiency factor), high confidence from genomic context alone (score 996 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3922c yidD membrane protein insertion efficiency factor 999 996 ctx neighborhood:881 coexpression:968 textmining:885
Rv3921c yidC membrane protein insertase YidC 997 993 ctx neighborhood:881 coexpression:947 textmining:683
Rv3920c hyp hypothetical protein 961 960 ctx neighborhood:792 coexpression:814
Rv3924c rpmH 50S ribosomal protein L34 994 936 ctx neighborhood:816 coexpression:667 textmining:923
Rv0682 rpsL 30S ribosomal protein S12 920 921 coexpression:921
Rv0702 rplD 50S ribosomal protein L4 929 914 coexpression:914
Rv0701 rplC 50S ribosomal protein L3 914 902 coexpression:902
Rv0719 rplF 50S ribosomal protein L6 900 900 coexpression:900
Rv1297 rho transcription termination factor Rho 902 873 coexpression:869
Rv0700 rpsJ 30S ribosomal protein S10 874 869 coexpression:869
Rv1630 rpsA 30S ribosomal protein S1 868 855 coexpression:847
Rv3457c rpoA DNA-directed RNA polymerase subunit alpha 859 841 coexpression:840
Rv0704 rplB 50S ribosomal protein L2 846 839 coexpression:839
Rv0703 rplW 50S ribosomal protein L23 833 833 coexpression:833
Rv0684 fusA1 elongation factor G 805 806 coexpression:806

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): ribonuclease P protein component
  • Pfam (hmmscan --cut_ga): Ribonuclease_P PF00825.25 (E=9e-22)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218440.3)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribonuclease_P (PF00825.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0594
  • Curated reference: UniProt P9WGZ3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 135 functional partner(s); context anchor yidD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3923c|rnpA
MIATPGLFAVLRARNRMRRSADFETTVKHGMRTVRSDMVVYWWRGSGGGPRVGLIIAKSVGSAVERHRVARRLRHVAGSIVKELHPSDHVVIRALPSSRHVSSARLEQQLRCGLRRAVELAGSDR