gid Resolved · high auto-curated
H37Rv Rv3919c · MTBC0 mtbc0_004153 ·
224 aa ·
4431779–4432453 MTBC0
(-) ·
RefSeq NP_218436.2
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG |
|---|---|
| MTBC0 PGAP re-annotation | 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG |
| Revised (this work) | 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG. Pfam: GidB (PF02527.22). |
| Functional category (TubercuList) | cell wall and cell processes |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 21 publications
21 TB publications mention this gene. 21 publication(s) discuss this gene (20 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Structural, functional and biophysical characterization of two cryptic RNA methyltransferases (Rv3366 and Rv3919c) of Mycobacterium tuberculosis. doi:10.1080/07391102.2026.2687102 | 2026 |
| Ubiquitylation by the GID/CTLH complex regulates the metabolic and innate immune response of macrophages to infection by Mycobacterium tuberculosis. doi:10.64898/2026.04.24.720540 | 2026 |
| Lineage identification and mutation profile of Mycobacterium tuberculosis: A study from National Reference Laboratory, India. doi:10.1016/j.ijmmb.2025.100925 | 2025 |
| An exploratory study on the application of nanopore sequencing for detecting Mycobacterium tuberculosis drug resistance in respiratory specimens. doi:10.1186/s12890-025-03747-1 | 2025 |
| Investigating the interaction pattern of FDA approved compounds with Mycobacterium tuberculosis GidB to understand their potential as antibiotics. doi:10.1080/07391102.2024.2434026 | 2026 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | parA (Rv3918c, - strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -2.81 (95% CI -8.09 to 3.14). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser EC |
2.1.1.-
· agrees with the atlas
|
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3950c
· 100.0% identity |
|---|---|
| M. leprae |
ML2708c
· 69.7% identity |
| M. marinum |
MMAR_5483
· 80.1% identity |
| M. smegmatis |
MSMEG_6940
· 66.7% identity |
| M. orygis |
RJtmp_004034
· 100.0% identity |
| M. abscessus |
MAB_4951c
· 63.1% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WGW9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Ribosomal RNA small subunit methyltransferase G |
| EC (curated) |
EC 2.1.1.-
|
| Curated function | Specifically methylates the N7 position of guanine in position 518 of 16S rRNA. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | rsmG |
| eggNOG description | Specifically methylates the N7 position of a guanine in 16S rRNA |
| Orthologous group | COG0357 |
| EC number |
EC 2.1.1.170
|
| KEGG orthology |
K03501
|
| Gene Ontology (60) |
GO:0000154, GO:0001510, GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006139, GO:0006364 +48 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.499 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 23 missense, 1 nonsense, 6 frameshift |
| Disruption | 7 distinct premature-stop/frameshift site(s); most common in 0.99% of strains (1438) · convergent |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 72.6%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 49.8% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 13 in the ORF — 0 in the essential state, 0 growth-defect, 13 non-essential, 0 growth-advantage. Saturation 0.923, mean read count 64.5. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Conditional fitness (RB-TnSeq, 95 conditions) stress
| Condition | Group | Direction | log2 fitness | t |
|---|---|---|---|---|
| Streptomycin sulfate salt | stress | mutant enriched (loss advantageous) | 2.695 | 7.88 |
Randomly-barcoded transposon screen across 95 carbon/nitrogen sources, pH, stressors and antibiotics (1 condition-specific phenotype(s) for this gene). A conditional fitness phenotype is a context lead, not a proven function, and never changes the verdict here. Note the blind spot: RB-TnSeq cannot measure essential genes. Source: RB-TnSeq 95-condition barcoded transposon screen, Mtb (PLoS Biol 2026, doi:10.1371/journal.pbio.3003529).
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection, day 45 (in vivo) | -3.47 | 0.0 | required |
| fitness after prolonged in vitro passage (in vitro passage) | -3.31 | 0.0 | required |
| fitness in mouse infection (in vivo) | +1.87 | 0.0042 | disruption advantageous |
| Differential genetic requirements of clinical Mtb strain (ID=663) from Euro-American lineage (compared to H37Rv control) (strain background) | +1.77 | 0.0042 | required |
Conditional fitness of transposon-disruption mutants across 4 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Drug resistance (WHO catalogue) streptomycin
| streptomycin | 523 catalogued resistance-associated variant(s) |
|---|
This gene carries mutations classed Associated with resistance (WHO grade 1–2) in the consolidated catalogue (WHO 2nd ed. 2023 + tb-profiler). Only the R-associated tier is shown; "uncertain" and empirical-only signals are excluded. Test a specific strain or variant with the resistance tester. Research context, not a clinical diagnostic.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 12.9 ppm · rank 2561/3519 (27.3th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 224 aa |
|---|---|
| Molecular weight | 24.0 kDa |
| Theoretical pI | 10.2 |
| GRAVY | 0.011 (hydrophobic) |
| Aliphatic index | 103.2 |
| Aromaticity | 0.036 |
| Instability index | 38.6 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
GidB | PF02527.22 | 3.1e-56 | 19–194 | rRNA small subunit methyltransferase G |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
7cfe |
X-ray diffraction | 2.02 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.0
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
7cfe-assembly1_A |
1.00 | 0.97 | 6.9e-41 sig | 7cfe-assembly1_A Crystal structure of RsmG methyltransferase of M. tuberculosis |
1xdz-assembly1_A |
1.00 | 0.81 | 3.6e-15 sig | 1xdz-assembly1_A Crystal Structure of Gram_Positive Bacillus subtilis Glucose inhibited Division protein B (gidB), Structural genomics, MCSG |
3g8b-assembly1_A |
1.00 | 0.80 | 9.2e-15 sig | 3g8b-assembly1_A T. thermophilus 16S rRNA G527 methyltransferase in complex with AdoMet in space group I222 |
3g89-assembly2_B |
1.00 | 0.70 | 1.7e-14 sig | 3g89-assembly2_B T. thermophilus 16S rRNA G527 methyltransferase in complex with AdoMet and AMP in space group P61 |
3g8a-assembly1_A |
1.00 | 0.69 | 1.6e-14 sig | 3g8a-assembly1_A T. thermophilus 16S rRNA G527 methyltransferase in complex with AdoHcy in space group P61 |
Foldseek search of the AlphaFold DB model (mean pLDDT 92.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | parA (- strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3920c (- strand, 131 bp gap) |
| Predicted operon |
parB · parA · gid
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
mftR (activates) · Rv2034 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: parB (chromosome partitioning protein ParB), high confidence from genomic context alone (score 981 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3917c parB |
chromosome partitioning protein ParB | 983 | 981 ctx | neighborhood:881 coexpression:850 |
Rv3918c parA |
chromosome partitioning protein ParA | 982 | 976 ctx | neighborhood:881 coexpression:803 |
Rv3920c hyp |
hypothetical protein | 947 | 938 ctx | neighborhood:727 coexpression:783 |
Rv3921c yidC |
membrane protein insertase YidC | 820 | 742 ctx | neighborhood:501 coexpression:505 |
Rv3923c rnpA |
ribonuclease P protein component | 857 | 663 ctx | neighborhood:501 textmining:595 |
Rv1713 engA |
GTPase Der | 615 | 615 ctx | cooccurence:572 |
Rv3922c yidD |
membrane protein insertion efficiency factor | 605 | 606 ctx | neighborhood:501 |
Rv1644 tsnR |
23S rRNA methyltransferase TsnR | 584 | 552 ctx | cooccurence:406 |
Rv2364c era |
GTPase Era | 538 | 539 ctx | cooccurence:530 |
Rv3916c hyp |
hypothetical protein | 531 | 531 ctx | neighborhood:524 |
Rv3924c rpmH |
50S ribosomal protein L34 | 656 | 516 ctx | neighborhood:501 |
Rv2647 hyp |
hypothetical protein | 553 | 503 | coexpression:474 |
Rv2921c ftsY |
signal recognition particle receptor FtsY | 613 | 495 ctx | cooccurence:417 |
Rv3579c rlmB |
23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | 519 | 481 ctx | cooccurence:459 |
Rv2883c pyrH |
uridylate kinase | 471 | 472 ctx | cooccurence:451 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG
- MTBC0 PGAP product: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG
- Pfam (hmmscan --cut_ga): GidB PF02527.22 (E=3e-56)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218436.2)
- Domains: Pfam-A via hmmscan --cut_ga — GidB (PF02527.22)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0357 - Curated reference: UniProt P9WGW9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.0)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
70 functional partner(s); context anchor
parB - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Drug resistance: consolidated catalogue, WHO 2nd ed. 2023 (9789240082410) + tb-profiler; only the resistance-associated tier (grade 1–2) is surfaced
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_004153|Rv3919c|gid MSPIEPAASAIFGPRLGLARRYAEALAGPGVERGLVGPREVGRLWDRHLLNCAVIGELLERGDRVVDIGSGAGLPGVPLAIARPDLQVVLLEPLLRRTEFLREMVTDLGVAVEIVRGRAEESWVQDQLGGSDAAVSRAVAALDKLTKWSMPLIRPNGRMLAIKGERAHDEVREHRRVMIASGAVDVRVVTCGANYLRPPATVVFARRGKQIARGSARMASGGTA
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for gid? Email the maintainer — the message is pre-filled with this gene's details.