gid Resolved · high auto-curated

H37Rv Rv3919c · MTBC0 mtbc0_004153 · 224 aa · 4431779–4432453 (-) · RefSeq NP_218436.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)16S rRNA (guanine(527)-N(7))-methyltransferase RsmG
MTBC0 PGAP re-annotation16S rRNA (guanine(527)-N(7))-methyltransferase RsmG
Revised (this work)16S rRNA (guanine(527)-N(7))-methyltransferase RsmG. Pfam: GidB (PF02527.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGW9 SwissProt · reviewed · Evidence at protein level
UniProt nameRibosomal RNA small subunit methyltransferase G
EC (curated) EC 2.1.1.-
Curated functionSpecifically methylates the N7 position of guanine in position 518 of 16S rRNA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namersmG
eggNOG descriptionSpecifically methylates the N7 position of a guanine in 16S rRNA
Orthologous groupCOG0357
EC number EC 2.1.1.170
KEGG orthology K03501
Gene Ontology (60) GO:0000154, GO:0001510, GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006139, GO:0006364 +48 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.499 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 23 missense, 1 nonsense, 6 frameshift
Disruption 7 distinct premature-stop/frameshift site(s); most common in 0.99% of strains (1438) · convergent

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GidBPF02527.22 3.1e-5619–194 rRNA small subunit methyltransferase G

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: parB (chromosome partitioning protein ParB), high confidence from genomic context alone (score 981 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3917c parB chromosome partitioning protein ParB 983 981 ctx neighborhood:881 coexpression:850
Rv3918c parA chromosome partitioning protein ParA 982 976 ctx neighborhood:881 coexpression:803
Rv3920c hyp hypothetical protein 947 938 ctx neighborhood:727 coexpression:783
Rv3921c yidC membrane protein insertase YidC 820 742 ctx neighborhood:501 coexpression:505
Rv3923c rnpA ribonuclease P protein component 857 663 ctx neighborhood:501 textmining:595
Rv1713 engA GTPase Der 615 615 ctx cooccurence:572
Rv3922c yidD membrane protein insertion efficiency factor 605 606 ctx neighborhood:501
Rv1644 tsnR 23S rRNA methyltransferase TsnR 584 552 ctx cooccurence:406
Rv2364c era GTPase Era 538 539 ctx cooccurence:530
Rv3916c hyp hypothetical protein 531 531 ctx neighborhood:524
Rv3924c rpmH 50S ribosomal protein L34 656 516 ctx neighborhood:501
Rv2647 hyp hypothetical protein 553 503 coexpression:474
Rv2921c ftsY signal recognition particle receptor FtsY 613 495 ctx cooccurence:417
Rv3579c rlmB 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB 519 481 ctx cooccurence:459
Rv2883c pyrH uridylate kinase 471 472 ctx cooccurence:451

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG
  • MTBC0 PGAP product: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG
  • Pfam (hmmscan --cut_ga): GidB PF02527.22 (E=3e-56)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218436.2)
  • Domains: Pfam-A via hmmscan --cut_ga — GidB (PF02527.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0357
  • Curated reference: UniProt P9WGW9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 70 functional partner(s); context anchor parB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004153|Rv3919c|gid
MSPIEPAASAIFGPRLGLARRYAEALAGPGVERGLVGPREVGRLWDRHLLNCAVIGELLERGDRVVDIGSGAGLPGVPLAIARPDLQVVLLEPLLRRTEFLREMVTDLGVAVEIVRGRAEESWVQDQLGGSDAAVSRAVAALDKLTKWSMPLIRPNGRMLAIKGERAHDEVREHRRVMIASGAVDVRVVTCGANYLRPPATVVFARRGKQIARGSARMASGGTA