Rv2908c Family assigned · medium auto-curated

H37Rv Rv2908c · MTBC0 mtbc0_003090 · 80 aa · 3237734–3237976 (-) · RefSeq NP_217424.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationRNA-binding protein
Revised (this work)RNA-binding protein. Pfam: KH_KhpA-B (PF13083.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFM7 SwissProt · reviewed · Evidence at protein level
UniProt nameRNA-binding protein KhpA
Curated functionA probable RNA-binding protein.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionBelongs to the UPF0109 family
Orthologous groupCOG1837
KEGG orthology K06960
Gene Ontology (2) GO:0008150, GO:0040007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
KH_KhpA-BPF13083.14 1.7e-207–69 KhpA/KhpB, KH domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rpsP (30S ribosomal protein S16), high confidence from genomic context alone (score 989 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2909c rpsP 30S ribosomal protein S16 990 989 ctx neighborhood:882 coexpression:911
Rv2907c rimM 16S rRNA processing protein RimM 960 959 ctx neighborhood:872 coexpression:692
Rv3920c hyp hypothetical protein 992 931 experimental:891 textmining:889
Rv3442c rpsI 30S ribosomal protein S9 902 903 coexpression:896
Rv2906c trmD tRNA (guanine-N1)-methyltransferase 885 885 ctx neighborhood:872
Rv2904c rplS 50S ribosomal protein L19 862 863 coexpression:840
Rv3458c rpsD 30S ribosomal protein S4 830 830 coexpression:827
Rv2785c rpsO 30S ribosomal protein S15 831 826 coexpression:823
Rv1643 rplT 50S ribosomal protein L20 810 811 coexpression:805
Rv1298 rpmE 50S ribosomal protein L31 780 780 coexpression:780
Rv2412 rpsT 30S ribosomal protein S20 780 780 coexpression:780
Rv0652 rplL 50S ribosomal protein L7/L12 781 774 coexpression:774
Rv3456c rplQ 50S ribosomal protein L17 738 738 coexpression:730
Rv0979A rpmF 50S ribosomal protein L32 735 736 coexpression:714
Rv2441c rpmA 50S ribosomal protein L27 709 710 coexpression:698

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: RNA-binding protein
  • Pfam (hmmscan --cut_ga): KH_KhpA-B PF13083.14 (E=2e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217424.1)
  • Domains: Pfam-A via hmmscan --cut_ga — KH_KhpA-B (PF13083.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1837
  • Curated reference: UniProt P9WFM7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 59 functional partner(s); context anchor rpsP
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003090|Rv2908c|
MSAVVVDAVEHLVRGIVDNPDDVRVDLITSRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGIGGRGIRVDVVDTDQ