trxB2 Resolved · high auto-curated
H37Rv Rv3913 · MTBC0 mtbc0_004147 ·
335 aa ·
4425979–4426986 MTBC0
(+) ·
RefSeq NP_218430.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | thioredoxin reductase |
|---|---|
| MTBC0 PGAP re-annotation | thioredoxin-disulfide reductase |
| Revised (this work) | Thioredoxin-disulfide reductase. Pfam: Pyr_redox_2 (PF07992.21), FAD_binding_2 (PF00890.31), Pyr_redox_3 (PF13738.13), Pyr_redox (PF00070.34). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 7 publications
7 TB publications mention this gene. 7 publication(s) discuss this gene (7 in a M. tuberculosis context, 2 in other mycobacteria — M. smegmatis (2)).
| Publication | Date |
|---|---|
| Targeting thioredoxin reductase for anti-tuberculosis drug discovery: the inhibitor OSSL_632214. doi:10.1007/s00253-026-13949-0 | 2026 |
| Genetic models of latent tuberculosis in mice reveal differential influence of adaptive immunity. doi:10.1084/jem.20210332 | 2021 |
| Protein tyrosine kinase, PtkA, is required for Mycobacterium tuberculosis growth in macrophages. doi:10.1038/s41598-017-18547-9 | 2018 |
| Mycobacterium tuberculosis Thioredoxin Reductase Is Essential for Thiol Redox Homeostasis but Plays a Minor Role in Antioxidant Defense. doi:10.1371/journal.ppat.1005675 | 2016 |
| Comparative proteome analysis of Mycobacterium tuberculosis grown under aerobic and anaerobic conditions. doi:10.1099/mic.0.27284-0 | 2004 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | trxC (Rv3914, + strand) |
|---|---|
| Overlap | 4 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Post-translational modifications
2 reported modified residue(s), incl. 1 phosphosite(s):
N-acetylthreonine @2, Phosphotyrosine; by PtkA @32.
Experimentally reported post-translational modification(s). A phosphosite indicates the protein is expressed and is a substrate of the M. tuberculosis Ser/Thr/Tyr kinase signalling network — a regulatory context, NOT a molecular function. Source: UniProt (Modified residue features; PTM sites curated from the M. tuberculosis literature).
CRISPRi vulnerability
Vulnerability index -7.06 (95% CI -8.35 to -5.67). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Enzyme that catalyse the reduction of disulphides by pyridine nucleotides through an enzyme disulphide and a flavin. Seems regulated by sigh (Rv3223c product). [catalytic activity: NADPH + oxidized thioredoxin = NADP(+) + reduced thioredoxin]. |
|---|---|
| Mycobrowser EC |
1.8.1.9
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3944
· 99.7% identity |
|---|---|
| M. leprae |
ML2703
· 83.2% identity |
| M. marinum |
MMAR_5477
· 89.4% identity |
| M. smegmatis |
MSMEG_6933
· 78.9% identity |
| M. orygis |
RJtmp_004028
· 99.7% identity |
| M. abscessus |
MAB_4940
· 76.5% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WHH1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Thioredoxin reductase |
| EC (curated) |
EC 1.8.1.9
|
| Curated function | Essential thiol-reducing enzyme that protects the cell from thiol-specific oxidizing stress. Plays a minor role in defense against oxidative and nitrosative stress. Is essential to establish and maintain infection in mice. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | trxB |
| eggNOG description | Belongs to the class-II pyridine nucleotide-disulfide oxidoreductase family |
| Orthologous group | COG0492 |
| EC number |
EC 1.8.1.9
|
| KEGG orthology |
K00384, K03671
|
| KEGG pathways |
map00450, map04621, map05418
|
| Gene Ontology (57) |
GO:0000166, GO:0001666, GO:0003674, GO:0003824, GO:0004791, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006950 +45 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.295 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.071 (low power)
· 6 consensus substitution(s) low power (6 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 84.4%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 62.6% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 18 in the ORF — 16 in the essential state, 0 growth-defect, 2 non-essential, 0 growth-advantage. Saturation 0.167, mean read count 14.6666666667. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | Rv3913-trxB2-TetOn18.2 (TetON promoter 18) |
|---|---|
| Baseline knockdown fitness | 4.107 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 269.0 ppm · rank 694/3519 (80.3th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 335 aa |
|---|---|
| Molecular weight | 35.6 kDa |
| Theoretical pI | 5.3 |
| GRAVY | -0.092 (hydrophilic) |
| Aliphatic index | 83.3 |
| Aromaticity | 0.06 |
| Instability index | 22.8 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Pyr_redox_2 | PF07992.21 | 1.2e-49 | 16–304 | Pyridine nucleotide-disulphide oxidoreductase |
FAD_binding_2 | PF00890.31 | 8.9e-05 | 16–51 | FAD binding domain |
Pyr_redox_3 | PF13738.13 | 1.8e-18 | 91–287 | Pyridine nucleotide-disulphide oxidoreductase |
Pyr_redox | PF00070.34 | 3.1e-18 | 158–230 | Pyridine nucleotide-disulphide oxidoreductase |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
2a87 |
X-ray diffraction | 3.0 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 91.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2a87-assembly1_B |
1.00 | 0.99 | 4.0e-60 sig | 2a87-assembly1_B Crystal Structure of M. tuberculosis Thioredoxin reductase |
5uth-assembly1_A |
1.00 | 0.99 | 2.6e-56 sig | 5uth-assembly1_A Crystal structure of thioredoxin reductase from Mycobacterium smegmatis in complex with FAD |
3itj-assembly2_B |
1.00 | 0.94 | 1.4e-43 sig | 3itj-assembly2_B Crystal structure of Saccharomyces cerevisiae thioredoxin reductase 1 (Trr1) |
7p9e-assembly1_A |
1.00 | 0.95 | 7.8e-43 sig | 7p9e-assembly1_A Chlamydomonas reinhardtii NADPH Dependent Thioredoxin Reductase 1 domain CS mutant |
4ccr-assembly1_A |
1.00 | 0.95 | 2.7e-42 sig | 4ccr-assembly1_A Crystal structure of the thioredoxin reductase apoenzyme from Entamoeba histolytica in the absence of the NADP cofactor |
Foldseek search of the AlphaFold DB model (mean pLDDT 91.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv3912 (+ strand, 93 bp gap) |
|---|---|
| Downstream (3' on genome) | trxC (+ strand, -4 bp gap) |
| Predicted operon |
trxB2 · trxC
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
sigH (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: trxC (thioredoxin TrxC), high confidence from genomic context alone (score 998 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3914 trxC exp |
thioredoxin TrxC | 999 | 998 ctx | neighborhood:882 fusion:890 experimental:770 textmining:951 |
Rv1471 trxB1 exp |
thioredoxin | 998 | 983 | experimental:770 database:900 textmining:886 |
Rv1464 csd exp |
cysteine desulfurase | 923 | 920 | database:900 |
Rv2428 ahpC exp |
alkyl hydroperoxide reductase subunit AhpC | 955 | 896 | coexpression:437 experimental:808 textmining:588 |
Rv1324 exp |
thioredoxin | 911 | 795 | experimental:770 textmining:589 |
Rv1470 trxA exp |
thioredoxin TrxA | 942 | 793 | experimental:770 textmining:736 |
Rv3912 rsmA |
anti-sigma-M factor RsmA | 776 | 777 ctx | neighborhood:776 |
Rv3910 murJ |
peptidoglycan biosynthesis protein | 717 | 657 ctx | neighborhood:653 |
Rv3915 cwlM |
peptidoglycan hydrolase | 708 | 653 ctx | neighborhood:632 |
Rv3911 sigM |
ECF RNA polymerase sigma factor SigM | 722 | 612 ctx | neighborhood:603 |
Rv3908 mutT4 |
mutator protein MutT | 625 | 607 ctx | neighborhood:549 |
Rv3909 hyp |
hypothetical protein | 549 | 549 ctx | neighborhood:549 |
Rv1937 exp |
oxygenase | 714 | 529 | experimental:456 textmining:420 |
Rv2874 dipZ exp |
integral membrane C-type cytochrome biogenesis protein DipZ | 661 | 529 | experimental:440 |
Rv1650 pheT |
phenylalanine--tRNA ligase subunit beta | 570 | 509 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: thioredoxin reductase
- MTBC0 PGAP product: thioredoxin-disulfide reductase
- Pfam (hmmscan --cut_ga): Pyr_redox_2 PF07992.21 (E=1e-49), FAD_binding_2 PF00890.31 (E=9e-05), Pyr_redox_3 PF13738.13 (E=2e-18), Pyr_redox PF00070.34 (E=3e-18)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218430.1)
- Domains: Pfam-A via hmmscan --cut_ga — Pyr_redox_2 (PF07992.21), FAD_binding_2 (PF00890.31), Pyr_redox_3 (PF13738.13), Pyr_redox (PF00070.34)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0492 - Curated reference: UniProt P9WHH1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 91.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
116 functional partner(s); context anchor
trxC - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_004147|Rv3913|trxB2 MTAPPVHDRAHHPVRDVIVIGSGPAGYTAALYAARAQLAPLVFEGTSFGGALMTTTDVENYPGFRNGITGPELMDEMREQALRFGADLRMEDVESVSLHGPLKSVVTADGQTHRARAVILAMGAAARYLQVPGEQELLGRGVSSCATCDGFFFRDQDIAVIGGGDSAMEEATFLTRFARSVTLVHRRDEFRASKIMLDRARNNDKIRFLTNHTVVAVDGDTTVTGLRVRDTNTGAETTLPVTGVFVAIGHEPRSGLVREAIDVDPDGYVLVQGRTTSTSLPGVFAAGDLVDRTYRQAVTAAGSGCAAAIDAERWLAEHAATGEADSTDALIGAQR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for trxB2? Email the maintainer — the message is pre-filled with this gene's details.