Rv3856c Family assigned · medium auto-curated
H37Rv Rv3856c · MTBC0 mtbc0_004089 ·
335 aa ·
4352511–4353518 MTBC0
(-) ·
RefSeq NP_218373.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | PHP domain-containing protein |
| Revised (this work) | PHP domain-containing protein. Pfam: HHH_8 (PF14716.14), PHP (PF02811.27). |
| Functional category (TubercuList) | conserved hypotheticals |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) never studied
No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.
A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 0.68 (95% CI -0.93 to 3.26). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser) ahead of Mycobrowser
| Mycobrowser function | Function unknown |
|---|
Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (COG category). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3886c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_5407
· 88.5% identity |
| M. smegmatis |
MSMEG_6445
· 82.0% identity |
| M. orygis |
RJtmp_003972
· 100.0% identity |
| M. abscessus |
MAB_0097
· 71.1% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P96221
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Polymerase/histidinol phosphatase N-terminal domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| Preferred name | polX |
| eggNOG description | PHP domain |
| Orthologous group | COG1387 |
| KEGG orthology |
K04477
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.336 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 86.1%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 6/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 58.7% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 12 in the ORF — 0 in the essential state, 0 growth-defect, 12 non-essential, 0 growth-advantage. Saturation 0.917, mean read count 137.818181818. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 13 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 47.0 ppm · rank 1795/3519 (49.0th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 335 aa |
|---|---|
| Molecular weight | 36.7 kDa |
| Theoretical pI | 5.71 |
| GRAVY | -0.359 (hydrophilic) |
| Aliphatic index | 89.0 |
| Aromaticity | 0.045 |
| Instability index | 35.3 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
HHH_8 | PF14716.14 | 5.3e-09 | 4–68 | Helix-hairpin-helix domain |
PHP | PF02811.27 | 9.9e-13 | 99–265 | PHP domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 97.5
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2w9m-assembly2_B |
1.00 | 0.83 | 5.6e-22 sig | 2w9m-assembly2_B Structure of family X DNA polymerase from Deinococcus radiodurans |
2w9m-assembly1_A |
1.00 | 0.78 | 9.6e-22 sig | 2w9m-assembly1_A Structure of family X DNA polymerase from Deinococcus radiodurans |
3b0x-assembly1_A |
1.00 | 0.71 | 1.8e-22 sig | 3b0x-assembly1_A K263A mutant of PolX from Thermus thermophilus HB8 complexed with Ca-dGTP |
3auo-assembly2_B |
1.00 | 0.70 | 2.5e-22 sig | 3auo-assembly2_B DNA polymerase X from Thermus thermophilus HB8 ternary complex with 1-nt gapped DNA and ddGTP |
3b0y-assembly1_A |
1.00 | 0.71 | 4.8e-22 sig | 3b0y-assembly1_A K263D mutant of PolX from Thermus thermophilus HB8 complexed with Ca-dGTP |
Foldseek search of the AlphaFold DB model (mean pLDDT 97.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | ethR (+ strand, 201 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3857c (- strand, 8 bp gap) |
| Predicted operon |
Rv3856c · Rv3857c
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
Rv3736 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv3857c (membrane protein), high confidence from genomic context alone (score 888 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3857c |
membrane protein | 888 | 888 ctx | neighborhood:882 |
Rv2367c ybeY |
endoribonuclease | 754 | 754 | coexpression:754 |
Rv3859c gltB |
glutamate synthase large subunit | 563 | 564 ctx | neighborhood:530 |
Rv3731 ligC |
DNA ligase C | 568 | 543 ctx | cooccurence:538 |
Rv1606 hisI |
phosphoribosyl-AMP cyclohydrolase | 563 | 482 | coexpression:439 |
Rv1601 hisB |
imidazole glycerol-phosphate dehydratase | 557 | 469 | coexpression:425 |
Rv0490 senX3 |
two component sensor histidine kinase SenX3 | 463 | 461 | coexpression:458 |
Rv1602 hisH |
imidazole glycerol phosphate synthase subunit HisH | 457 | 418 | |
Rv2964 purU |
formyltetrahydrofolate deformylase | 403 | 404 | coexpression:402 |
Rv1599 hisD |
histidinol dehydrogenase | 461 | 358 | |
Rv1605 hisF |
imidazole glycerol phosphate synthase subunit HisF | 447 | 312 | |
Rv0938 ligD |
multifunctional non-homologous end joining DNA repair protein/ATP dependent DNA ligase LigD | 427 | 248 | |
Rv1316c ogt |
methylated-DNA--protein-cysteine methyltransferase | 569 | 118 | textmining:532 |
Rv0670 end |
endonuclease IV | 826 | 68 | textmining:821 |
Rv0429c def |
polypeptide deformylase | 772 | 56 | textmining:769 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: PHP domain-containing protein
- Pfam (hmmscan --cut_ga): HHH_8 PF14716.14 (E=5e-09), PHP PF02811.27 (E=1e-12)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218373.1)
- Domains: Pfam-A via hmmscan --cut_ga — HHH_8 (PF14716.14), PHP (PF02811.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1387 - Curated reference: UniProt P96221 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 97.5)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
15 functional partner(s); context anchor
Rv3857c - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_004089|Rv3856c| MDPVTALRQIAYYKDRNRHDPRRVMAYRNAADIIEGLDDAARQRHGQANSWQSLAGIGPKTAKVIAQAWSGREPDLLAELRADAEDLGGGAIRAALRGDLHLHSNWSDGSAPIEEMMATAAALGHQYCALTDHSPRLTIANGLSPDRLRKQLDVIDELREKFAPLRILTGIEVDILEDGSLDQEPEMLDRLDIVVASVHSKLSMDSAAMTRRMVRAVANGHTDVLGHCTGRLIAGNRGIRPESKFDAEAVFTACREHGTAVEINSRPERRDPPTRLLHLARDIGCVFSIDTDAHAPGQLDFLGYGAQRALDAEVPADRIVNTWPADTLLAWTGSH
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv3856c? Email the maintainer — the message is pre-filled with this gene's details.