Rv3856c Family assigned · medium auto-curated

H37Rv Rv3856c · MTBC0 mtbc0_004089 · 335 aa · 4352511–4353518 (-) · RefSeq NP_218373.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationPHP domain-containing protein
Revised (this work)PHP domain-containing protein. Pfam: HHH_8 (PF14716.14), PHP (PF02811.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P96221 TrEMBL · unreviewed · Evidence at protein level
UniProt namePolymerase/histidinol phosphatase N-terminal domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namepolX
eggNOG descriptionPHP domain
Orthologous groupCOG1387
KEGG orthology K04477

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.336 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HHH_8PF14716.14 5.3e-094–68 Helix-hairpin-helix domain
PHPPF02811.27 9.9e-1399–265 PHP domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3857c (membrane protein), high confidence from genomic context alone (score 888 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3857c membrane protein 888 888 ctx neighborhood:882
Rv2367c ybeY endoribonuclease 754 754 coexpression:754
Rv3859c gltB glutamate synthase large subunit 563 564 ctx neighborhood:530
Rv3731 ligC DNA ligase C 568 543 ctx cooccurence:538
Rv1606 hisI phosphoribosyl-AMP cyclohydrolase 563 482 coexpression:439
Rv1601 hisB imidazole glycerol-phosphate dehydratase 557 469 coexpression:425
Rv0490 senX3 two component sensor histidine kinase SenX3 463 461 coexpression:458
Rv1602 hisH imidazole glycerol phosphate synthase subunit HisH 457 418
Rv2964 purU formyltetrahydrofolate deformylase 403 404 coexpression:402
Rv1599 hisD histidinol dehydrogenase 461 358
Rv1605 hisF imidazole glycerol phosphate synthase subunit HisF 447 312
Rv0938 ligD multifunctional non-homologous end joining DNA repair protein/ATP dependent DNA ligase LigD 427 248
Rv1316c ogt methylated-DNA--protein-cysteine methyltransferase 569 118 textmining:532
Rv0670 end endonuclease IV 826 68 textmining:821
Rv0429c def polypeptide deformylase 772 56 textmining:769

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: PHP domain-containing protein
  • Pfam (hmmscan --cut_ga): HHH_8 PF14716.14 (E=5e-09), PHP PF02811.27 (E=1e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218373.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HHH_8 (PF14716.14), PHP (PF02811.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1387
  • Curated reference: UniProt P96221 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 15 functional partner(s); context anchor Rv3857c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004089|Rv3856c|
MDPVTALRQIAYYKDRNRHDPRRVMAYRNAADIIEGLDDAARQRHGQANSWQSLAGIGPKTAKVIAQAWSGREPDLLAELRADAEDLGGGAIRAALRGDLHLHSNWSDGSAPIEEMMATAAALGHQYCALTDHSPRLTIANGLSPDRLRKQLDVIDELREKFAPLRILTGIEVDILEDGSLDQEPEMLDRLDIVVASVHSKLSMDSAAMTRRMVRAVANGHTDVLGHCTGRLIAGNRGIRPESKFDAEAVFTACREHGTAVEINSRPERRDPPTRLLHLARDIGCVFSIDTDAHAPGQLDFLGYGAQRALDAEVPADRIVNTWPADTLLAWTGSH