glpQ1 Resolved · high auto-curated

H37Rv Rv3842c · MTBC0 mtbc0_004072 · 274 aa · 4338849–4339673 (-) · RefSeq NP_218359.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)glycerophosphoryl diester phosphodiesterase
MTBC0 PGAP re-annotationglycerophosphodiester phosphodiesterase
Revised (this work)Glycerophosphodiester phosphodiesterase. Pfam: GDPD (PF03009.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WMU3 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable glycerophosphodiester phosphodiesterase 1
EC (curated) EC 3.1.4.46
Curated functionGlycerophosphodiester phosphodiesterase hydrolyzes glycerophosphodiesters into glycerol-3-phosphate (G3P) and the corresponding alcohol.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred nameglpQ
eggNOG descriptionglycerophosphoryl diester phosphodiesterase
Orthologous groupCOG0584
EC number EC 3.1.4.46
KEGG orthology K01126
KEGG pathways map00564

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.729 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 7 missense, 1 nonsense, 1 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.13% of strains (191) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GDPDPF03009.24 4.4e-6117–258 Glycerophosphoryl diester phosphodiesterase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2277c (glycerolphosphodiesterase), high confidence from genomic context alone (score 953 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2277c glycerolphosphodiesterase 952 953 ctx cooccurence:546 database:900
Rv0317c glpQ2 glycerophosphoryl diester phosphodiesterase GlpQ 952 952 ctx cooccurence:543 database:900
Rv3843c transmembrane protein 889 889 ctx neighborhood:882
Rv2249c glpD1 glycerol-3-phosphate dehydrogenase 759 744 database:500
Rv3302c glpD2 glycerol-3-phosphate dehydrogenase 750 735 database:500
Rv3696c glpK glycerol kinase 668 551 coexpression:445
Rv0178 Mce associated membrane protein 427 407 database:401
Rv0200 transmembrane protein 425 405 database:401
Rv3492c Mce associated protein 424 403 database:401
Rv2390c hyp hypothetical protein 424 403 database:401
Rv1362c membrane protein 424 403 database:401
Rv1363c membrane protein 424 403 database:401
Rv0199 membrane protein 424 403 database:401
Rv1973 Mce associated membrane protein 422 401 database:401
Rv0177 Mce associated protein 422 401 database:401

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: glycerophosphoryl diester phosphodiesterase
  • MTBC0 PGAP product: glycerophosphodiester phosphodiesterase
  • Pfam (hmmscan --cut_ga): GDPD PF03009.24 (E=4e-61)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218359.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GDPD (PF03009.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0584
  • Curated reference: UniProt P9WMU3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 34 functional partner(s); context anchor Rv2277c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004072|Rv3842c|glpQ1
MTWADEVLAGHPFVVAHRGASAARPEHTLAAYDLALKEGADGVECDVRLTRDGHLVCVHDRRLDRTSTGAGLVSTMTLAQLRELEYGAWHDSWRPDGSHGDTSLLTLDALVSLVLDWHRPVKIFVETKHPVRYGSLVENKLLALLHRFGIAAPASADRSRAVVMSFSAAAVWRIRRAAPLLPTVLLGKTPRYLTSSAATAVGATAVGPSLPALKEYPQLVDRSAAQGRAVYCWNVDEYEDIDFCREVGVAWIGTHHPGRTKAWLEDGRANGTTR