glpQ1 Resolved · high auto-curated

H37Rv Rv3842c · MTBC0 mtbc0_004072 · 274 aa · 4338849–4339673 MTBC0 (-) · RefSeq NP_218359.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv2792c (Rv2792c) — family_assigned: IS607-like element IS1537 family transposase Rv3829c (Rv3829c) — requalified: NAD(P)/FAD-dependent oxidoreductase Rv3829c Rv3830c (Rv3830c) — family_assigned: TetR/AcrR family transcriptional regulator Rv3831 (Rv3831) — family_assigned: DUF2834 domain-containing protein Rv3832c (Rv3832c) — family_assigned: methyltransferase domain-containing protein Rv3833 (Rv3833) — family_assigned: helix-turn-helix transcriptional regulator serS (Rv3834c) — requalified: serine--tRNA ligase serS Rv3835 (Rv3835) — family_assigned: septum formation family protein Rv3835 Rv3836 (Rv3836) — family_assigned: metallopeptidase family protein Rv3837c (Rv3837c) — family_assigned: histidine phosphatase family protein pheA (Rv3838c) — requalified: prephenate dehydratase pheA Rv3839 (Rv3839) — requalified: DUF2470 domain-containing protein bfrB (Rv3841) — requalified: ferritin BfrB glpQ1 (Rv3842c) — requalified: glycerophosphodiester phosphodiesterase glpQ1 Rv3843c (Rv3843c) — family_assigned: DUF4328 domain-containing protein Rv3843c Rv3845 (Rv3845) — family_assigned: IS110 family transposase sodA (Rv3846) — requalified: superoxide dismutase Rv3847 (Rv3847) — requalified: peptidase Rv3848 (Rv3848) — family_assigned: TMEM165/GDT1 family protein Rv3848 espR (Rv3849) — family_assigned: type VII secretion system ESX-1 transcriptional regulator Es Rv3850 (Rv3850) — family_assigned: DUF6474 family protein Rv3851 (Rv3851) — dark: hypothetical protein hns (Rv3852) — family_assigned: histone-like protein Hns rraA (Rv3853) — requalified: ribonuclease E activity regulator RraA ethA (Rv3854c) — requalified: FAD-containing monooxygenase EthA ethA 4 328 kb 4 332 kb 4 336 kb 4 340 kb 4 344 kb 4 348 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)glycerophosphoryl diester phosphodiesterase
MTBC0 PGAP re-annotationglycerophosphodiester phosphodiesterase
Revised (this work)Glycerophosphodiester phosphodiesterase. Pfam: GDPD (PF03009.24).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 1 publication

1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context).

PublicationDate
Loss of glycerol catabolism confers carbon-source-dependent artemisinin resistance in Mycobacterium tuberculosis. doi:10.1128/aac.00645-24 2024

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Intrinsic disorder (sequence + structure) partially disordered

Predicted disorder19% of residues (metapredict) · mean AlphaFold pLDDT 93.5
Disordered regions2 IDR(s), longest 39 aa [176-215, 260-274]

carries a substantial disordered region (53/274 residues); disorder is a property, not a function

A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).

CRISPRi vulnerability

Vulnerability index 0.04 (95% CI -1.56 to 2.14). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionGlycerophosphoryl diester phosphodiesterase hydrolyzes deacylated phospholipids to G3P and the corresponding alcohols [catalytic activity: a glycerophosphodiester + H(2)O = an alcohol + SN-glycerol 3-phosphate].
Mycobrowser EC 3.1.4.46 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3872c · 100.0% identity
M. leprae ML0074 · 87.9% identity
M. marinum MMAR_5394 · 88.8% identity
M. smegmatis MSMEG_6423 · 79.0% identity
M. orygis RJtmp_003956 · 100.0% identity
M. abscessus MAB_0123 · 77.4% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WMU3 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable glycerophosphodiester phosphodiesterase 1
EC (curated) EC 3.1.4.46
Curated functionGlycerophosphodiester phosphodiesterase hydrolyzes glycerophosphodiesters into glycerol-3-phosphate (G3P) and the corresponding alcohol.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred nameglpQ
eggNOG descriptionglycerophosphoryl diester phosphodiesterase
Orthologous groupCOG0584
EC number EC 3.1.4.46
KEGG orthology K01126
KEGG pathways map00564

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.729 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 7 missense, 1 nonsense, 1 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.13% of strains (191) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 2 consensus substitution(s)
low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 89.0% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 9/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 52.7%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callGA · growth-advantage
What the call meansgrowth-advantage: insertions enriched
TA sites (Himar1) 13 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 13 growth-advantage. Saturation 1.000, mean read count 345.846153846. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Conditional fitness (RB-TnSeq, 95 conditions) stress

ConditionGroupDirectionlog2 fitnesst
2-Mercaptopyridine N-oxide sodium salt stress mutant enriched (loss advantageous) 1.353 7.435

Randomly-barcoded transposon screen across 95 carbon/nitrogen sources, pH, stressors and antibiotics (1 condition-specific phenotype(s) for this gene). A conditional fitness phenotype is a context lead, not a proven function, and never changes the verdict here. Note the blind spot: RB-TnSeq cannot measure essential genes. Source: RB-TnSeq 95-condition barcoded transposon screen, Mtb (PLoS Biol 2026, doi:10.1371/journal.pbio.3003529).

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection (in vivo) +2.490.0 disruption advantageous
altered fitness under Ethambutol (drug exposure) +1.880.0 disruption advantageous
fitness in mouse infection (in vivo) +1.880.027 disruption advantageous
fitness in mouse infection (in vivo) +1.790.039 disruption advantageous
fitness in mouse infection (in vivo) +1.710.049 disruption advantageous
fitness in mouse infection (in vivo) +1.260.0 disruption advantageous
Mutants exhibiting altered fitness in the absence of gene marP (other) -1.230.0037 required

Conditional fitness of transposon-disruption mutants across 7 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 11 of 16 independent MS datasets
Integrated abundance68.3 ppm · rank 1551/3519 (56.0th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length274 aa
Molecular weight29.9 kDa
Theoretical pI7.21
GRAVY-0.121 (hydrophilic)
Aliphatic index91.2
Aromaticity0.073
Instability index26.0 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GDPDPF03009.24 4.4e-6117–258 Glycerophosphoryl diester phosphodiesterase family

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.5

PDB hitprobTM-scoreE-valueDescription
2pz0-assembly1_A 1.00 0.92 2.7e-22 sig 2pz0-assembly1_A Crystal structure of Glycerophosphodiester Phosphodiesterase (GDPD) from T. tengcongensis
5t91-assembly1_A 1.00 0.86 3.1e-23 sig 5t91-assembly1_A Crystal structure of B. subtilis 168 GlpQ in complex with bicine
5t9b-assembly1_G 1.00 0.85 5.5e-23 sig 5t9b-assembly1_G Crystal structure of B. subtilis 168 GlpQ in complex with glycerol-3-phosphate (5 minute soak)
4r7o-assembly4_D 1.00 0.82 4.8e-23 sig 4r7o-assembly4_D Crystal Structure of Putative Glycerophosphoryl Diester Phosphodiesterasefrom Bacillus anthraci
5t9c-assembly1_E 1.00 0.85 4.2e-22 sig 5t9c-assembly1_E Crystal structure of B. subtilis 168 GlpQ in complex with glycerol-3-phosphate (1 hour soak)

Foldseek search of the AlphaFold DB model (mean pLDDT 93.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Catalytic-site verification (M-CSA on the structural model) active site conserved

M-CSA entry300 · EC 3.1.4.46
Catalytic residues7/8 identical (8/8 aligned)
VerdictACTIVE-SITE CONSERVED (7/8 catalytic residues identical) -> likely active enzyme

Catalytic residues of the matched M-CSA reference enzyme mapped onto the structural model by alignment. An active-site-conserved verdict upgrades a mere fold match to a likely active enzyme; fold-only flags a shared fold whose catalytic machinery is not retained (a guard against over-calling).

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)bfrB (+ strand, 14 bp gap)
Downstream (3' on genome)Rv3843c (- strand, 5 bp gap)
Predicted operon glpQ1 · Rv3843c

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) Rv2011c (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv2277c (glycerolphosphodiesterase), high confidence from genomic context alone (score 953 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2277c exp glycerolphosphodiesterase 952 953 ctx cooccurence:546 database:900
Rv0317c glpQ2 exp glycerophosphoryl diester phosphodiesterase GlpQ 952 952 ctx cooccurence:543 database:900
Rv3843c transmembrane protein 889 889 ctx neighborhood:882
Rv2249c glpD1 exp glycerol-3-phosphate dehydrogenase 759 744 database:500
Rv3302c glpD2 exp glycerol-3-phosphate dehydrogenase 750 735 database:500
Rv3696c glpK glycerol kinase 668 551 coexpression:445
Rv0178 exp Mce associated membrane protein 427 407 database:401
Rv0200 exp transmembrane protein 425 405 database:401
Rv3492c exp Mce associated protein 424 403 database:401
Rv2390c hyp exp hypothetical protein 424 403 database:401
Rv1362c exp membrane protein 424 403 database:401
Rv1363c exp membrane protein 424 403 database:401
Rv0199 exp membrane protein 424 403 database:401
Rv1973 exp Mce associated membrane protein 422 401 database:401
Rv0177 exp Mce associated protein 422 401 database:401

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: glycerophosphoryl diester phosphodiesterase
  • MTBC0 PGAP product: glycerophosphodiester phosphodiesterase
  • Pfam (hmmscan --cut_ga): GDPD PF03009.24 (E=4e-61)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218359.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GDPD (PF03009.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0584
  • Curated reference: UniProt P9WMU3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.5)
  • Catalytic-site verification: M-CSA (Ribeiro et al. 2018, doi:10.1093/nar/gkx1012), entry 300; catalytic residues aligned onto the structural model
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 34 functional partner(s); context anchor Rv2277c
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004072|Rv3842c|glpQ1
MTWADEVLAGHPFVVAHRGASAARPEHTLAAYDLALKEGADGVECDVRLTRDGHLVCVHDRRLDRTSTGAGLVSTMTLAQLRELEYGAWHDSWRPDGSHGDTSLLTLDALVSLVLDWHRPVKIFVETKHPVRYGSLVENKLLALLHRFGIAAPASADRSRAVVMSFSAAAVWRIRRAAPLLPTVLLGKTPRYLTSSAATAVGATAVGPSLPALKEYPQLVDRSAAQGRAVYCWNVDEYEDIDFCREVGVAWIGTHHPGRTKAWLEDGRANGTTR