Rv3742c Resolved · medium auto-curated

H37Rv Rv3742c · MTBC0 - · 131 aa · 4192850–4193245 (-) · RefSeq NP_218259.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)oxidoreductase
MTBC0 PGAP re-annotation
Revised (this work)Oxidoreductase.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O69709 TrEMBL · unreviewed · Inferred from homology
UniProt namePossible oxidoreductase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred nameethA
eggNOG descriptionFlavin-binding monooxygenase-like
Orthologous groupCOG2072
KEGG orthology K10215
KEGG pathways map00627, map01120

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.12% of strains (175) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3741c (oxidoreductase), high confidence from genomic context alone (score 996 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3741c oxidoreductase 996 996 ctx neighborhood:882 cooccurence:774 coexpression:860
Rv3740c diacyglycerol O-acyltransferase 978 979 ctx neighborhood:882 coexpression:804
Rv3743c ctpJ cation transporter ATPase J 673 532 ctx neighborhood:497
Rv1393c monoxygenase 516 517 ctx cooccurence:514
Rv0892 monooxygenase 466 466 ctx cooccurence:466
Rv3049c monooxygenase 441 441 ctx cooccurence:434
Rv1308 atpA ATP synthase subunit alpha 435 436 experimental:427
Rv1507c hyp hypothetical protein 412 412
Rv1309 atpG ATP synthase subunit gamma 411 411
Rv3456c rplQ 50S ribosomal protein L17 410 410
Rv3739c PPE67 PPE family protein PPE67 407 407 ctx neighborhood:404
Rv1310 atpD ATP synthase subunit beta 403 404
Rv3461c rpmJ 50S ribosomal protein L36 402 403
Rv3846 sodA superoxide dismutase 405 396
Rv0363c fba fructose-bisphosphate aldolase 412 390

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): oxidoreductase
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218259.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2072
  • Curated reference: UniProt O69709 (TrEMBL, unreviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 25 functional partner(s); context anchor Rv3741c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3742c|
MHSEQSASIEHVDVLIVGAGISGTGAAYYLKTMQPAKTFAIVEARYPAIRSDSDLHTFSYEFKPWQHEKATASADAIMVHRGRSLAGGDRTLRHRRTRHHELRMVIIGSGATAVTLVPAMAQTAGAVTMPK