Rv3741c Resolved · medium auto-curated
H37Rv Rv3741c · MTBC0 - ·
224 aa · 4192179–4192853 (-) ·
RefSeq NP_218258.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | oxidoreductase |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Oxidoreductase. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
O69708
TrEMBL · unreviewed
· Inferred from homology
|
|---|---|
| UniProt name | Possible oxidoreductase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
P Inorganic ion transport and metabolism
|
|---|---|
| Preferred name | ethA |
| eggNOG description | Flavin-binding monooxygenase-like |
| Orthologous group | COG2072 |
| KEGG orthology |
K10215
|
| KEGG pathways |
map00627, map01120
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.14 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv3742c (oxidoreductase), high confidence from genomic context alone (score 996 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3742c |
oxidoreductase | 996 | 996 ctx | neighborhood:882 cooccurence:774 coexpression:860 |
Rv3740c |
diacyglycerol O-acyltransferase | 980 | 981 ctx | neighborhood:882 coexpression:822 |
Rv3743c ctpJ |
cation transporter ATPase J | 535 | 531 ctx | neighborhood:497 |
Rv1393c |
monoxygenase | 522 | 522 ctx | cooccurence:519 |
Rv0892 |
monooxygenase | 467 | 467 ctx | cooccurence:467 |
Rv3049c |
monooxygenase | 449 | 449 ctx | cooccurence:441 |
Rv1308 atpA |
ATP synthase subunit alpha | 435 | 436 | experimental:427 |
Rv1507c hyp |
hypothetical protein | 412 | 412 | |
Rv1309 atpG |
ATP synthase subunit gamma | 411 | 411 | |
Rv3456c rplQ |
50S ribosomal protein L17 | 408 | 409 | |
Rv3739c PPE67 |
PPE family protein PPE67 | 408 | 408 ctx | neighborhood:404 |
Rv1310 atpD |
ATP synthase subunit beta | 403 | 404 | |
Rv3461c rpmJ |
50S ribosomal protein L36 | 401 | 402 | |
Rv3846 sodA |
superoxide dismutase | 403 | 394 | |
Rv0363c fba |
fructose-bisphosphate aldolase | 411 | 389 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): oxidoreductase
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218258.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2072 - Curated reference: UniProt O69708 (TrEMBL, unreviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
17 functional partner(s); context anchor
Rv3742c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3741c| MIGRDRAYAVTRRKDIAKQRLVWRLCQRYPRAARRLIRHLNAKQLAAGYPADEHFKPVYNPWDQRLCAVPDADMFKAIRDGRASVVTEAIDTFTENGIRLQSGRELAADISITATGLNLLAFGGINLSVDGVAVDVAEKVAFKGFLLSDVSNFAGPHGRTRAHHLLSAAARSHADPAAAGRRSPLADLKVLREGPVDDDHLRFTTSASASRLTVKRITRSTPWN