Rv1393c Resolved · high auto-curated

H37Rv Rv1393c · MTBC0 mtbc0_001494 · 492 aa · 1577453–1578931 (-) · RefSeq NP_215909.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)monoxygenase
MTBC0 PGAP re-annotationNAD(P)/FAD-dependent oxidoreductase
Revised (this work)NAD(P)/FAD-dependent oxidoreductase. Pfam: Pyr_redox_2 (PF07992.21), Pyr_redox_3 (PF13738.13), NAD_binding_8 (PF13450.13), FMO-like (PF00743.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71662 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable monoxygenase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
eggNOG descriptionflavoprotein involved in K transport
Orthologous groupCOG2072
EC number EC 1.14.13.22
KEGG orthology K03379
KEGG pathways map00930, map01120, map01220

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.215 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Pyr_redox_2PF07992.21 5.8e-096–214 Pyridine nucleotide-disulphide oxidoreductase
Pyr_redox_3PF13738.13 2.1e-188–205 Pyridine nucleotide-disulphide oxidoreductase
NAD_binding_8PF13450.13 4.8e-099–75 NAD(P)-binding Rossmann-like domain
FMO-likePF00743.26 7.3e-0679–224 Flavin-binding monooxygenase-like

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cyp132 (cytochrome P450 Cyp132), high confidence from genomic context alone (score 985 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1394c cyp132 cytochrome P450 Cyp132 985 985 ctx neighborhood:882 coexpression:860
Rv1395 HTH-type transcriptional regulator 829 829 ctx neighborhood:784
Rv1399c nlhH carboxylesterase NlhH 624 622 ctx neighborhood:544
Rv1401 membrane protein 534 534 ctx neighborhood:462
Rv3741c oxidoreductase 522 522 ctx cooccurence:519
Rv3742c oxidoreductase 516 517 ctx cooccurence:514
Rv1402 priA primosomal protein N' 496 495 ctx neighborhood:492
Rv1834 lipZ hydrolase 441 441
Rv1308 atpA ATP synthase subunit alpha 437 437 experimental:427
Rv1245c short-chain type dehydrogenase/reductase 424 424 ctx cooccurence:418
Rv2913c D-amino acid aminohydrolase 423 424 ctx cooccurence:419
Rv1507c hyp hypothetical protein 412 413
Rv1309 atpG ATP synthase subunit gamma 409 410
Rv3456c rplQ 50S ribosomal protein L17 407 407
Rv1310 atpD ATP synthase subunit beta 403 404

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: monoxygenase
  • MTBC0 PGAP product: NAD(P)/FAD-dependent oxidoreductase
  • Pfam (hmmscan --cut_ga): Pyr_redox_2 PF07992.21 (E=6e-09), Pyr_redox_3 PF13738.13 (E=2e-18), NAD_binding_8 PF13450.13 (E=5e-09), FMO-like PF00743.26 (E=7e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215909.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Pyr_redox_2 (PF07992.21), Pyr_redox_3 (PF13738.13), NAD_binding_8 (PF13450.13), FMO-like (PF00743.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2072
  • Curated reference: UniProt P71662 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 37 functional partner(s); context anchor cyp132
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001494|Rv1393c|
MMPDYHALIVGAGFSGIGAAIKLDRAGFSDYLVVEAGDGVGGTWHWNTYPGIAVDIPSFSYQFSFEQSRHWSRTYAPGHELKAYAEHCVDKYGIRSRIRLNTKVLAAEFDDEHSLWRVQTDPGGEITARFLISACGILTVPKLPDIDGVDSFEGVTMHTARWDHTQDLTGKRVGIIGTGASAVQVIPEMAPIVSHLTVFQRTPIWCFPKFDVPLPTAVRWAMRIPGGKAVHRLLSQAFVEATFPIAAHYFAVFPLAKHMESAGRRYLRQQVHDPVVREQLTPRYAVGCKRPGFHNTYLSTFNRDNVRLVTEPIDKITPTAVATTDGASHEIDVLVLATGFKVLDTDSIPTYAVTGTGGASLSRFWDEHRLQAYEGVSVPGYPNFFTVFGPYGYVGSSYFALIETQAHHIIRCLKRARRTGATRIEVTEEANARYFAEVMRRRHRQVFWQDSCRLANSYYFDKNGDVPLRPTTTVEAYWRSRRFDLGDYRISS