Rv3749c Family assigned · medium auto-curated

H37Rv Rv3749c · MTBC0 - · 169 aa · 4197628–4198137 (-) · RefSeq NP_218266.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains VapC50_C (PF26343.1) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L0TGF0 SwissProt · reviewed · Evidence at protein level
UniProt namePutative ribonuclease VapC50
EC (curated) EC 3.1.-.-
Curated functionToxic component of a type II toxin-antitoxin (TA) system. An RNase. The cognate antitoxin is VapB50.

UniProt still lists this protein as Putative ribonuclease VapC50; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionPIN domain
Orthologous groupCOG1569

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.165 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
VapC50_CPF26343.1 1.0e-1498–151 VapC50 C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapB50 (excisionase), high confidence from genomic context alone (score 962 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3750c vapB50 excisionase 994 962 ctx neighborhood:786 cooccurence:774 textmining:853
Rv2310 excisionase 800 801 ctx cooccurence:774
Rv0330c hyp hypothetical protein 459 459 ctx cooccurence:456
Rv2018 vapB45 hyp hypothetical protein 695 379 textmining:529
Rv1045 hyp hypothetical protein 409 369
Rv0837c hyp hypothetical protein 413 343
Rv1246c relE toxin RelE 492 314
Rv3181c vapB49 antitoxin VapB45 588 194 textmining:511
Rv2022c higB2 hyp hypothetical protein 693 157 textmining:651
Rv3357 relJ antitoxin RelJ 655 73 textmining:644
Rv2021c higA2 transcriptional regulator 656 57 textmining:651
Rv0624 vapC30 ribonuclease VapC30 519 55 textmining:512
Rv0065 vapC1 ribonuclease VapC1 669 53 textmining:665
Rv3183 higA3 transcriptional regulator 654 52 textmining:650
Rv0299 toxin 810 50 textmining:809

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): VapC50_C PF26343.1 (E=1e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218266.1)
  • Domains: Pfam-A via hmmscan --cut_ga — VapC50_C (PF26343.1)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1569
  • Curated reference: UniProt L0TGF0 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor vapB50
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3749c|
MPCCGSLTRAPIGLCGRRTSWPRLGEPWSTASTSAPNGLTTAFAFGYNDLIAAMNNHYKDRHVLAAAVRERAEVIVTTNLKHFPDDALKPYQIKALHPDDFLLDQLDLYEEATKAVILGMVDAYIDPPFTPHSLLDALGEQVPQFAAKARRLFPSGSPFGLGVLLPFDQ