PE34 Family assigned · medium auto-curated
H37Rv Rv3746c · MTBC0 - ·
111 aa · 4196171–4196506 (-) ·
RefSeq YP_178011.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | PE family protein PE34 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | PE family protein PE34. Pfam: PE (PF00934.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
Q79FA1
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Probable PE family protein PE34 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | PE family |
| Orthologous group | 2AXVZ |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PE | PF00934.26 | 8.4e-10 | 4–91 | PE family |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3745c hyp |
hypothetical protein | 688 | 688 ctx | neighborhood:688 |
Rv3747 hyp |
hypothetical protein | 542 | 542 ctx | neighborhood:542 |
Rv3873 PPE68 |
PPE family protein PPE68 | 527 | 303 | |
Rv3866 espG1 |
ESX-1 secretion-associated protein EspG | 441 | 99 | textmining:406 |
Rv0453 PPE11 |
PPE family protein PPE11 | 655 | 41 | textmining:655 |
Rv1088 PE9 |
PE family protein PE9 | 630 | 41 | textmining:630 |
Rv3739c PPE67 |
PPE family protein PPE67 | 564 | 41 | textmining:564 |
Rv1089 PE10 |
PE family protein PE10; Together with PE9, induces macrophage apoptosis through human Toll-like receptor 4 (TLR4) signaling pathway. Interac | 547 | 41 | textmining:547 |
Rv0834c PE_PGRS14 |
PE-PGRS family protein PE_PGRS14 | 537 | 41 | textmining:538 |
Rv3533c PPE62 |
PPE family protein PPE62 | 437 | 41 | textmining:437 |
Rv2396 PE_PGRS41 |
acid and phagosome regulated protein AprC | 434 | 41 | textmining:434 |
Rv0274 hyp |
hypothetical protein | 410 | 41 | textmining:411 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE family protein PE34
- Pfam (hmmscan --cut_ga): PE PF00934.26 (E=8e-10)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_178011.1)
- Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2AXVZ - Curated reference: UniProt Q79FA1 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 12 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3746c|PE34 MQSMSFDPAVADIGSQVVNNAFQGLQAGAVAWVSLSSLLPAGAEEVSAWAVTAFTTAATGLLALNQAAQEELRKAGEVFTAIARMYSDADVRAAACLLEAIPRPGQTLARE