ligC Resolved · high auto-curated
H37Rv Rv3731 · MTBC0 mtbc0_003956 ·
358 aa · 4205879–4206955 (+) ·
RefSeq NP_218248.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | DNA ligase C |
|---|---|
| MTBC0 PGAP re-annotation | ATP-dependent DNA ligase |
| Revised (this work) | ATP-dependent DNA ligase. Pfam: DNA_ligase_A_M (PF01068.27), DNA_ligase_A_C (PF04679.22). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
L0TDE1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | DNA ligase C |
| EC (curated) |
EC 6.5.1.1
|
| Curated function | DNA ligase that seals nicks in double-stranded DNA during DNA replication, DNA recombination and DNA repair. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
L Replication, recombination and repair
|
|---|---|
| Preferred name | ligC |
| eggNOG description | DNA ligase |
| Orthologous group | COG1793 |
| Gene Ontology (48) |
GO:0003674, GO:0003824, GO:0003909, GO:0003910, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0006139, GO:0006259, GO:0006260, GO:0006261 +36 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.278 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DNA_ligase_A_M | PF01068.27 | 3.4e-44 | 11–201 | ATP dependent DNA ligase domain |
DNA_ligase_A_C | PF04679.22 | 3.0e-12 | 221–332 | ATP dependent DNA ligase C terminal region |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mku (non-homologous end joining protein Ku), high confidence from genomic context alone (score 840 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3730c ligD hyp |
hypothetical protein | 996 | 995 ctx | neighborhood:789 fusion:895 cooccurence:773 |
Rv0269c hyp |
hypothetical protein | 981 | 975 ctx | fusion:878 cooccurence:773 |
Rv2116 lppK |
lipoprotein LppK | 893 | 887 | experimental:629 database:609 |
Rv0002 dnaN |
DNA polymerase III subunit beta | 892 | 886 | experimental:629 database:609 |
Rv2090 |
5'-3' exonuclease | 858 | 849 | experimental:429 database:569 |
Rv0937c mku |
non-homologous end joining protein Ku | 983 | 840 ctx | cooccurence:765 textmining:901 |
Rv1629 polA |
DNA polymerase I | 906 | 840 | experimental:454 database:569 textmining:439 |
Rv0114 gmhB |
D-glycero-alpha-D-manno-heptose-1,7-bisphosphate 7-phosphatase | 761 | 737 | database:597 |
Rv0427c xthA |
exodeoxyribonuclease III protein XthA | 726 | 699 | database:644 |
Rv1278 hyp |
hypothetical protein | 711 | 680 | database:611 |
Rv1329c dinG |
ATP-dependent helicase DinG | 707 | 680 | database:604 |
Rv1277 hyp |
hypothetical protein | 708 | 677 | database:611 |
Rv2828A hyp |
hypothetical protein | 657 | 657 ctx | cooccurence:657 |
Rv2101 helZ |
helicase HelZ | 675 | 643 | database:581 |
Rv2903c lepB |
signal peptidase | 654 | 638 | database:626 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: DNA ligase C
- MTBC0 PGAP product: ATP-dependent DNA ligase
- Pfam (hmmscan --cut_ga): DNA_ligase_A_M PF01068.27 (E=3e-44), DNA_ligase_A_C PF04679.22 (E=3e-12)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218248.1)
- Domains: Pfam-A via hmmscan --cut_ga — DNA_ligase_A_M (PF01068.27), DNA_ligase_A_C (PF04679.22)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1793 - Curated reference: UniProt L0TDE1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
73 functional partner(s); context anchor
mku - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003956|Rv3731|ligC MQLPVMPPVSPMLAKSVTAIPPDASYEPKWDGFRSICFRDGDQVELGSRNERPMTRYFPELVAAIRAELPHRCVIDGEIIIATDHGLDFEALQQRIHPAESRVRMLADRTPASFIAFDLLALGDDDYTGRPFSERRAALVDAVTGSGADADLSIHVTPATTDMATAQRWFSEFEGAGLDGVIAKPPHITYQPDKRVMFKIKHLRTADCVVAGYRVHKSGSDAIGSLLLGLYQEDGQLASVGVIGAFPMAERRRLLTELQPLVTSFDDHPWNWAAHVAGQRTPRKNEFSRWNVGKDLSFVPLRPERVVEVRYDHMEGARFRHTAQFNRWRPDRDPRSCSYAQLERPLTVSLSDIVPGLR