ligC Resolved · high auto-curated
H37Rv Rv3731 · MTBC0 mtbc0_003956 ·
358 aa ·
4205879–4206955 MTBC0
(+) ·
RefSeq NP_218248.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | DNA ligase C |
|---|---|
| MTBC0 PGAP re-annotation | ATP-dependent DNA ligase |
| Revised (this work) | ATP-dependent DNA ligase. Pfam: DNA_ligase_A_M (PF01068.27), DNA_ligase_A_C (PF04679.22). |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 9 publications
9 TB publications mention this gene. 9 publication(s) discuss this gene (4 in a M. tuberculosis context, 3 in other mycobacteria — M. smegmatis (3)).
| Publication | Date |
|---|---|
| Genomic Surveillance of 3R Genes Associated with Antibiotic Resistance in Mycobacterium tuberculosis Isolates from Kazakhstan. doi:10.3390/antibiotics15010026 | 2025 |
| ATP-Dependent Ligases and AEP Primases Affect the Profile and Frequency of Mutations in Mycobacteria under Oxidative Stress. doi:10.3390/genes12040547 | 2021 |
| DNA Ligase C and Prim-PolC participate in base excision repair in mycobacteria. doi:10.1038/s41467-017-01365-y | 2017 |
| DNA ligase C1 mediates the LigD-independent nonhomologous end-joining pathway of Mycobacterium smegmatis. doi:10.1128/JB.01832-14 | 2014 |
| Resolving lineage assignation on Mycobacterium tuberculosis clinical isolates classified by spoligotyping with a new high-throughput 3R SNPs based method. doi:10.1016/j.meegid.2010.07.006 | 2010 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 1.16 (95% CI -0.28 to 3.74). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | This protein seals during DNA replication, DNA recombination and DNA repair NICKS in double-stranded DNA [catalytic activity: ATP + (deoxyribonucleotide)(N) + (deoxyribonucleotide)(M) = AMP + pyrophosphate + (deoxyribonucleotide)(N+M)]. |
|---|---|
| Mycobrowser EC |
6.5.1.1
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3758
· 99.7% identity |
|---|---|
| M. marinum |
MMAR_5266
· 85.7% identity |
| M. smegmatis |
MSMEG_6304
· 76.1% identity |
| M. orygis |
RJtmp_003838
· 99.7% identity |
| M. abscessus |
MAB_0279c
· 80.1% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
L0TDE1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | DNA ligase C |
| EC (curated) |
EC 6.5.1.1
|
| Curated function | DNA ligase that seals nicks in double-stranded DNA during DNA replication, DNA recombination and DNA repair. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
L Replication, recombination and repair
|
|---|---|
| Preferred name | ligC |
| eggNOG description | DNA ligase |
| Orthologous group | COG1793 |
| Gene Ontology (48) |
GO:0003674, GO:0003824, GO:0003909, GO:0003910, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0006139, GO:0006259, GO:0006260, GO:0006261 +36 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.278 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 50/53 (94%) · mean identity 84.3%
· 4/4 closest MTBAP relatives conserved across the genus (present in 50/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 6/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 58.5% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 19 in the ORF — 0 in the essential state, 0 growth-defect, 19 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 203.368421053. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 27.4 ppm · rank 2123/3519 (39.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 358 aa |
|---|---|
| Molecular weight | 40.1 kDa |
| Theoretical pI | 6.42 |
| GRAVY | -0.334 (hydrophilic) |
| Aliphatic index | 80.9 |
| Aromaticity | 0.084 |
| Instability index | 42.8 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DNA_ligase_A_M | PF01068.27 | 3.4e-44 | 11–201 | ATP dependent DNA ligase domain |
DNA_ligase_A_C | PF04679.22 | 3.0e-12 | 221–332 | ATP dependent DNA ligase C terminal region |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 89.2
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3rr5-assembly1_A |
1.00 | 0.54 | 2.4e-24 sig | 3rr5-assembly1_A DNA ligase from the archaeon Thermococcus sp. 1519 |
6wbo-assembly1_A |
1.00 | 0.51 | 3.9e-24 sig | 6wbo-assembly1_A DNA-Ligase from Thermococcus gammatolerans |
2cfm-assembly1_A |
1.00 | 0.51 | 2.0e-23 sig | 2cfm-assembly1_A ATP-DEPENDENT DNA LIGASE FROM PYROCOCCUS FURIOSUS |
4eq5-assembly1_A |
1.00 | 0.51 | 1.8e-23 sig | 4eq5-assembly1_A DNA ligase from the archaeon Thermococcus sibiricus |
1vs0-assembly1_A |
1.00 | 0.57 | 2.0e-21 sig | 1vs0-assembly1_A Crystal Structure of the Ligase Domain from M. tuberculosis LigD at 2.4A |
Foldseek search of the AlphaFold DB model (mean pLDDT 89.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv3730c (- strand, 37 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3732 (+ strand, 99 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: mku (non-homologous end joining protein Ku), high confidence from genomic context alone (score 840 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3730c ligD hyp |
hypothetical protein | 996 | 995 ctx | neighborhood:789 fusion:895 cooccurence:773 |
Rv0269c hyp |
hypothetical protein | 981 | 975 ctx | fusion:878 cooccurence:773 |
Rv2116 lppK exp |
lipoprotein LppK | 893 | 887 | experimental:629 database:609 |
Rv0002 dnaN exp |
DNA polymerase III subunit beta | 892 | 886 | experimental:629 database:609 |
Rv2090 exp |
5'-3' exonuclease | 858 | 849 | experimental:429 database:569 |
Rv0937c mku |
non-homologous end joining protein Ku | 983 | 840 ctx | cooccurence:765 textmining:901 |
Rv1629 polA exp |
DNA polymerase I | 906 | 840 | experimental:454 database:569 textmining:439 |
Rv0114 gmhB exp |
D-glycero-alpha-D-manno-heptose-1,7-bisphosphate 7-phosphatase | 761 | 737 | database:597 |
Rv0427c xthA exp |
exodeoxyribonuclease III protein XthA | 726 | 699 | database:644 |
Rv1278 hyp exp |
hypothetical protein | 711 | 680 | database:611 |
Rv1329c dinG exp |
ATP-dependent helicase DinG | 707 | 680 | database:604 |
Rv1277 hyp exp |
hypothetical protein | 708 | 677 | database:611 |
Rv2828A hyp |
hypothetical protein | 657 | 657 ctx | cooccurence:657 |
Rv2101 helZ exp |
helicase HelZ | 675 | 643 | database:581 |
Rv2903c lepB exp |
signal peptidase | 654 | 638 | database:626 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: DNA ligase C
- MTBC0 PGAP product: ATP-dependent DNA ligase
- Pfam (hmmscan --cut_ga): DNA_ligase_A_M PF01068.27 (E=3e-44), DNA_ligase_A_C PF04679.22 (E=3e-12)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218248.1)
- Domains: Pfam-A via hmmscan --cut_ga — DNA_ligase_A_M (PF01068.27), DNA_ligase_A_C (PF04679.22)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1793 - Curated reference: UniProt L0TDE1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 89.2)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
73 functional partner(s); context anchor
mku - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003956|Rv3731|ligC MQLPVMPPVSPMLAKSVTAIPPDASYEPKWDGFRSICFRDGDQVELGSRNERPMTRYFPELVAAIRAELPHRCVIDGEIIIATDHGLDFEALQQRIHPAESRVRMLADRTPASFIAFDLLALGDDDYTGRPFSERRAALVDAVTGSGADADLSIHVTPATTDMATAQRWFSEFEGAGLDGVIAKPPHITYQPDKRVMFKIKHLRTADCVVAGYRVHKSGSDAIGSLLLGLYQEDGQLASVGVIGAFPMAERRRLLTELQPLVTSFDDHPWNWAAHVAGQRTPRKNEFSRWNVGKDLSFVPLRPERVVEVRYDHMEGARFRHTAQFNRWRPDRDPRSCSYAQLERPLTVSLSDIVPGLR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for ligC? Email the maintainer — the message is pre-filled with this gene's details.