gmhB Resolved · medium auto-curated

H37Rv Rv0114 · MTBC0 mtbc0_000124 · 190 aa · 138106–138678 (+) · RefSeq NP_214628.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)D-glycero-alpha-D-manno-heptose-1,7-bisphosphate 7-phosphatase
MTBC0 PGAP re-annotationD-glycero-alpha-D-manno-heptose-1%2C7-bisphosphate 7-phosphatase
Revised (this work)D-glycero-alpha-D-manno-heptose-1%2C7-bisphosphate 7-phosphatase.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WMV3 SwissProt · reviewed · Inferred from homology
UniProt nameD-glycero-alpha-D-manno-heptose-1,7-bisphosphate 7-phosphatase
EC (curated) EC 3.1.3.83
Curated functionConverts the D-glycero-alpha-D-manno-heptose 1,7-bisphosphate intermediate into D-glycero-alpha-D-manno-heptose 1-phosphate by removing the phosphate group at the C-7 position.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namegmhB
eggNOG descriptionD,D-heptose 1,7-bisphosphate phosphatase
Orthologous groupCOG0241
EC number EC 3.1.3.82, EC 3.1.3.83
KEGG orthology K03273
KEGG pathways map00540, map01100
KEGG modules M00064
Gene Ontology (21) GO:0000287, GO:0003674, GO:0003824, GO:0005488, GO:0006793, GO:0006796, GO:0008150, GO:0008152, GO:0008270, GO:0009987, GO:0016311, GO:0016787 +9 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.806 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 5 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.29% of strains (416) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: hddA (D-alpha-D-heptose-7-phosphate kinase HddA), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0115 hddA D-alpha-D-heptose-7-phosphate kinase HddA 999 999 ctx neighborhood:802 cooccurence:699 coexpression:860 database:900
Rv0113 gmhA phosphoheptose isomerase 999 993 ctx neighborhood:713 cooccurence:774 coexpression:907 textmining:895
Rv0112 gca GDP-mannose 4,6-dehydratase 937 934 ctx neighborhood:509 coexpression:829
Rv0938 ligD multifunctional non-homologous end joining DNA repair protein/ATP dependent DNA ligase LigD 771 749 database:597
Rv3062 ligB DNA ligase 762 738 database:597
Rv3731 ligC DNA ligase C 761 737 database:597
Rv1602 hisH imidazole glycerol phosphate synthase subunit HisH 742 703 coexpression:679
Rv1605 hisF imidazole glycerol phosphate synthase subunit HisF 740 672 coexpression:645
Rv1599 hisD histidinol dehydrogenase 748 671 coexpression:644
Rv3264c manB D-alpha-D-mannose-1-phosphate guanylyltransferase ManB 714 671 ctx fusion:571
Rv1603 hisA 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 746 669 coexpression:642
Rv2231c cobC aminotransferase 605 564 coexpression:547
Rv1600 hisC1 histidinol-phosphate aminotransferase 605 564 coexpression:547
Rv3772 hisC2 histidinol-phosphate aminotransferase 605 564 coexpression:547
Rv2121c hisG ATP phosphoribosyltransferase 653 548 coexpression:511

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: D-glycero-alpha-D-manno-heptose-1,7-bisphosphate 7-phosphatase
  • MTBC0 PGAP product: D-glycero-alpha-D-manno-heptose-1%2C7-bisphosphate 7-phosphatase
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214628.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0241
  • Curated reference: UniProt P9WMV3 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor hddA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000124|Rv0114|gmhB
MVAERAGHQWCLFLDRDGVINRQVVGDYVRNWRQFEWLPGAARALKKLRAWAPYIVVVTNQQGVGAGLMSAVDVMVIHRHLQMQLASDGVLIDGFQVCPHHRSQRCGCRKPRPGLVLDWLGRHPDSEPLLSIVVGDSLSDLELAHNVAAAAGACASVQIGGASSGGVADASFDSLWEFAVAVGHARGERG