gmhB Resolved · medium auto-curated

H37Rv Rv0114 · MTBC0 mtbc0_000124 · 190 aa · 138106–138678 MTBC0 (+) · RefSeq NP_214628.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)D-glycero-alpha-D-manno-heptose-1,7-bisphosphate 7-phosphatase
MTBC0 PGAP re-annotationD-glycero-alpha-D-manno-heptose-1%2C7-bisphosphate 7-phosphatase
Revised (this work)D-glycero-alpha-D-manno-heptose-1%2C7-bisphosphate 7-phosphatase.
Functional category (TubercuList)cell wall and cell processes

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 1 publication

1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context).

PublicationDate
Low-resolution SAXS and structural dynamics analysis on M. tuberculosis GmhB enzyme involved in GDP-heptose biosynthetic pathway. doi:10.1016/j.ijbiomac.2019.06.035 2019

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene

NeighbourhddA (Rv0115, + strand)
Overlap1 bp, 0 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index 0.06 (95% CI -1.20 to 1.51). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in biosynthesis of nucleotide-activated glycero-manno-heptose. Involved in two pathways, D-alpha-D pathway [catalytic activity: D-glycero-alpha-D-manno-heptose 1,7-biphosphate = D-glycero-alpha-D-manno-heptose 1-phosphate] and L-beta-D pathway [catalytic activity: D-glycero-beta-D-manno-heptose 1,7-biphosphate = D-glycero-beta-D-manno-heptose 1-phosphate].
Mycobrowser EC 3.1.3.- · superseded EC numbering; the atlas uses the current class (3.1.3.82, 3.1.3.83)

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0118 · 99.5% identity
M. orygis RJtmp_000124 · 100.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WMV3 SwissProt · reviewed · Inferred from homology
UniProt nameD-glycero-alpha-D-manno-heptose-1,7-bisphosphate 7-phosphatase
EC (curated) EC 3.1.3.83
Curated functionConverts the D-glycero-alpha-D-manno-heptose 1,7-bisphosphate intermediate into D-glycero-alpha-D-manno-heptose 1-phosphate by removing the phosphate group at the C-7 position.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namegmhB
eggNOG descriptionD,D-heptose 1,7-bisphosphate phosphatase
Orthologous groupCOG0241
EC number EC 3.1.3.82, EC 3.1.3.83
KEGG orthology K03273
KEGG pathways map00540, map01100
KEGG modules M00064
Gene Ontology (21) GO:0000287, GO:0003674, GO:0003824, GO:0005488, GO:0006793, GO:0006796, GO:0008150, GO:0008152, GO:0008270, GO:0009987, GO:0016311, GO:0016787 +9 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.806 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 5 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.29% of strains (416) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 18/53 (34%) · mean identity 36.0% · 0/4 closest MTBAP relatives
present in a subset of the genus (18/53 NTM; in 0 of the 4 closest MTBAP relatives) — partial/intermediate conservation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 2/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 36.1%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 10 in the ORF — 0 in the essential state, 0 growth-defect, 10 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 173. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 6 of 16 independent MS datasets
Integrated abundance0.77 ppm · rank 3312/3519 (5.9th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length190 aa
Molecular weight20.5 kDa
Theoretical pI7.08
GRAVY0.045 (hydrophobic)
Aliphatic index94.9
Aromaticity0.068
Instability index28.5 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.0

PDB hitprobTM-scoreE-valueDescription
3l8h-assembly4_D 1.00 0.86 2.7e-15 sig 3l8h-assembly4_D Crystal Structure of D,D-heptose 1.7-bisphosphate phosphatase from B. bronchiseptica complexed with magnesium and phosphate
3l8f-assembly1_A 1.00 0.80 2.3e-13 sig 3l8f-assembly1_A Crystal Structure of D,D-heptose 1.7-bisphosphate phosphatase from E. Coli complexed with magnesium and phosphate
2fpu-assembly1_A 1.00 0.85 2.5e-10 sig 2fpu-assembly1_A Crystal Structure of the N-terminal domain of E.coli HisB- Complex with histidinol
2fpx-assembly1_A 1.00 0.85 3.1e-10 sig 2fpx-assembly1_A Crystal Structure of the N-terminal Domain of E.coli HisB- Sulfate complex.
2o2x-assembly1_A 1.00 0.75 5.1e-11 sig 2o2x-assembly1_A Crystal structure of a putative had-like phosphatase (mll2559) from mesorhizobium loti at 1.50 A resolution

Foldseek search of the AlphaFold DB model (mean pLDDT 93.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 3

Upstream (5' on genome)gmhA (+ strand, 31 bp gap)
Downstream (3' on genome)hddA (+ strand, -1 bp gap)
Predicted operon gmhA · gmhB · hddA

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (12 TF) Rv0023 (represses) · Rv0081 (activates) · Rv0273c (represses) · mmpR5 (activates) · phoP (activates) · trcR (activates) · Rv1776c (represses) · Rv1990c (represses) · Rv3050c (represses) · mtrA (represses) · Rv3736 (activates) · tcrX (activates)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: hddA (D-alpha-D-heptose-7-phosphate kinase HddA), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0115 hddA exp D-alpha-D-heptose-7-phosphate kinase HddA 999 999 ctx neighborhood:802 cooccurence:699 coexpression:860 database:900
Rv0113 gmhA phosphoheptose isomerase 999 993 ctx neighborhood:713 cooccurence:774 coexpression:907 textmining:895
Rv0112 gca GDP-mannose 4,6-dehydratase 937 934 ctx neighborhood:509 coexpression:829
Rv0938 ligD exp multifunctional non-homologous end joining DNA repair protein/ATP dependent DNA ligase LigD 771 749 database:597
Rv3062 ligB exp DNA ligase 762 738 database:597
Rv3731 ligC exp DNA ligase C 761 737 database:597
Rv1602 hisH imidazole glycerol phosphate synthase subunit HisH 742 703 coexpression:679
Rv1605 hisF imidazole glycerol phosphate synthase subunit HisF 740 672 coexpression:645
Rv1599 hisD histidinol dehydrogenase 748 671 coexpression:644
Rv3264c manB D-alpha-D-mannose-1-phosphate guanylyltransferase ManB 714 671 ctx fusion:571
Rv1603 hisA 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 746 669 coexpression:642
Rv2231c cobC aminotransferase 605 564 coexpression:547
Rv1600 hisC1 histidinol-phosphate aminotransferase 605 564 coexpression:547
Rv3772 hisC2 histidinol-phosphate aminotransferase 605 564 coexpression:547
Rv2121c hisG ATP phosphoribosyltransferase 653 548 coexpression:511

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: D-glycero-alpha-D-manno-heptose-1,7-bisphosphate 7-phosphatase
  • MTBC0 PGAP product: D-glycero-alpha-D-manno-heptose-1%2C7-bisphosphate 7-phosphatase
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214628.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0241
  • Curated reference: UniProt P9WMV3 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.0)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor hddA
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000124|Rv0114|gmhB
MVAERAGHQWCLFLDRDGVINRQVVGDYVRNWRQFEWLPGAARALKKLRAWAPYIVVVTNQQGVGAGLMSAVDVMVIHRHLQMQLASDGVLIDGFQVCPHHRSQRCGCRKPRPGLVLDWLGRHPDSEPLLSIVVGDSLSDLELAHNVAAAAGACASVQIGGASSGGVADASFDSLWEFAVAVGHARGERG