Rv3726 Resolved · high auto-curated

H37Rv Rv3726 · MTBC0 mtbc0_003951 · 397 aa · 4195542–4196735 (+) · RefSeq NP_218243.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)dehydrogenase
MTBC0 PGAP re-annotationzinc-binding dehydrogenase
Revised (this work)Zinc-binding dehydrogenase. Pfam: ADH_N (PF08240.18).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O69693 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible dehydrogenase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred nameadhE2_1
eggNOG descriptionDehydrogenase
Orthologous groupCOG1063

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.437 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 7 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.18% of strains (256) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ADH_NPF08240.18 6.0e-1123–136 Alcohol dehydrogenase GroES-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: adh (alcohol dehydrogenase), high confidence from genomic context alone (score 739 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1530 adh alcohol dehydrogenase 738 739 ctx cooccurence:738
Rv3086 adhD alcohol dehydrogenase D 513 493 ctx cooccurence:425
Rv0162c adhE1 zinc-type alcohol dehydrogenase subunit E 511 491 ctx cooccurence:426
Rv3725 oxidoreductase 476 454 ctx neighborhood:427
Rv1569 bioF1 8-amino-7-oxononanoate synthase 486 453 coexpression:422
Rv0032 bioF2 8-amino-7-oxononanoate synthase 486 453 coexpression:422
Rv1862 adhA alcohol dehydrogenase A 475 450
Rv1194c hyp hypothetical protein 438 439 ctx cooccurence:436
Rv2370c hyp hypothetical protein 438 438 ctx cooccurence:433
Rv1453 transcriptional activator protein 436 437 ctx cooccurence:431
Rv0761c adhB alcohol dehydrogenase B 453 430
Rv3846 sodA superoxide dismutase 455 429 coexpression:428
Rv3727 oxidoreductase 417 417 ctx neighborhood:415
Rv1326c glgB 1,4-alpha-glucan branching protein 444 412 coexpression:405
Rv1562c treZ malto-oligosyltrehalose trehalohydrolase 443 411 coexpression:404

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: dehydrogenase
  • MTBC0 PGAP product: zinc-binding dehydrogenase
  • Pfam (hmmscan --cut_ga): ADH_N PF08240.18 (E=6e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218243.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ADH_N (PF08240.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1063
  • Curated reference: UniProt O69693 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor adh
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003951|Rv3726|
MKAVTCTNAKLEVVDRPSPAPAKGQLLLDVLRCGICGSDLHARLHCDELADVMAESGYHAFMRSNQQVVFGHEFCGEVVDYGPGTRRTPRRGTPVVAMPLLRRGNKEVHGIGLSTMAPGAYAERLVVEQSLTFPVPNGLAPEIAALTEPMAVGWHAVRRGEVGKGDVAIVIGCGPIGLAVICMLKSRGVHTVIASDFSPGRRALATACGADSVVDPVQDSPYAVAAGLGQGNRHLQSILDAFDLAVGTVERLQRLRLPWWHLWRAAEAAGAATPKRPVIFECVGVPGIIDGIIASAPLFSRVVVVGVCMGSDHIRPAMAINKEINLRFVLGYTPLEFRDTLHMLADGKVNAAPLITGTVGLPGVAAAFDALGDPEAHAKIMIDPKSNAASPQPFRVE