Rv3726 Resolved · high auto-curated
H37Rv Rv3726 · MTBC0 mtbc0_003951 ·
397 aa ·
4195542–4196735 MTBC0
(+) ·
RefSeq NP_218243.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | dehydrogenase |
|---|---|
| MTBC0 PGAP re-annotation | zinc-binding dehydrogenase |
| Revised (this work) | Zinc-binding dehydrogenase. Pfam: ADH_N (PF08240.18). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) never studied
No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 0.85 (95% CI -0.53 to 3.15). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Function unknown; probably involved in cellular metabolism. |
|---|---|
| Mycobrowser EC |
1.-.-.-
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3753
· 99.7% identity |
|---|---|
| M. marinum |
MMAR_3328
· 43.1% identity |
| M. smegmatis |
MSMEG_6108
· 39.3% identity |
| M. orygis |
RJtmp_003833
· 99.5% identity |
| M. abscessus |
MAB_0526c
· 42.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O69693
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible dehydrogenase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| Preferred name | adhE2_1 |
| eggNOG description | Dehydrogenase |
| Orthologous group | COG1063 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 2.437 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 7 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.18% of strains (256) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 51/53 (96%) · mean identity 55.5%
· 4/4 closest MTBAP relatives conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 6/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 47.1% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | GA · growth-advantage |
|---|---|
| What the call means | growth-advantage: insertions enriched |
| TA sites (Himar1) | 16 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 16 growth-advantage. Saturation 0.938, mean read count 98. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 12 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 134.0 ppm · rank 1081/3519 (69.3th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 397 aa |
|---|---|
| Molecular weight | 42.0 kDa |
| Theoretical pI | 7.18 |
| GRAVY | 0.183 (hydrophobic) |
| Aliphatic index | 97.3 |
| Aromaticity | 0.053 |
| Instability index | 49.3 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ADH_N | PF08240.18 | 6.0e-11 | 23–136 | Alcohol dehydrogenase GroES-like domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.5
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6ie0-assembly2_D |
1.00 | 0.82 | 6.0e-30 sig | 6ie0-assembly2_D X-ray crystal structure of 2R,3R-butanediol dehydrogenase from Bacillus subtilis |
3qe3-assembly1_A |
1.00 | 0.84 | 7.6e-29 sig | 3qe3-assembly1_A Sheep liver sorbitol dehydrogenase |
4ejm-assembly1_A |
1.00 | 0.81 | 9.0e-28 sig | 4ejm-assembly1_A Crystal structure of a putative zinc-binding dehydrogenase (Target PSI-012003) from Sinorhizobium meliloti 1021 bound to NADP |
2dq4-assembly1_A |
1.00 | 0.84 | 6.2e-27 sig | 2dq4-assembly1_A Crystal structure of threonine 3-dehydrogenase |
5kia-assembly1_A-2 |
1.00 | 0.80 | 1.4e-27 sig | 5kia-assembly1_A-2 Crystal structure of L-threonine 3-dehydrogenase from Burkholderia thailandensis |
Foldseek search of the AlphaFold DB model (mean pLDDT 94.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv3725 (+ strand, 277 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3727 (+ strand, 340 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: adh (alcohol dehydrogenase), high confidence from genomic context alone (score 739 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1530 adh |
alcohol dehydrogenase | 738 | 739 ctx | cooccurence:738 |
Rv3086 adhD |
alcohol dehydrogenase D | 513 | 493 ctx | cooccurence:425 |
Rv0162c adhE1 |
zinc-type alcohol dehydrogenase subunit E | 511 | 491 ctx | cooccurence:426 |
Rv3725 |
oxidoreductase | 476 | 454 ctx | neighborhood:427 |
Rv1569 bioF1 |
8-amino-7-oxononanoate synthase | 486 | 453 | coexpression:422 |
Rv0032 bioF2 |
8-amino-7-oxononanoate synthase | 486 | 453 | coexpression:422 |
Rv1862 adhA |
alcohol dehydrogenase A | 475 | 450 | |
Rv1194c hyp |
hypothetical protein | 438 | 439 ctx | cooccurence:436 |
Rv2370c hyp |
hypothetical protein | 438 | 438 ctx | cooccurence:433 |
Rv1453 |
transcriptional activator protein | 436 | 437 ctx | cooccurence:431 |
Rv0761c adhB |
alcohol dehydrogenase B | 453 | 430 | |
Rv3846 sodA |
superoxide dismutase | 455 | 429 | coexpression:428 |
Rv3727 |
oxidoreductase | 417 | 417 ctx | neighborhood:415 |
Rv1326c glgB |
1,4-alpha-glucan branching protein | 444 | 412 | coexpression:405 |
Rv1562c treZ |
malto-oligosyltrehalose trehalohydrolase | 443 | 411 | coexpression:404 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: dehydrogenase
- MTBC0 PGAP product: zinc-binding dehydrogenase
- Pfam (hmmscan --cut_ga): ADH_N PF08240.18 (E=6e-11)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218243.1)
- Domains: Pfam-A via hmmscan --cut_ga — ADH_N (PF08240.18)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1063 - Curated reference: UniProt O69693 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.5)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
19 functional partner(s); context anchor
adh - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003951|Rv3726| MKAVTCTNAKLEVVDRPSPAPAKGQLLLDVLRCGICGSDLHARLHCDELADVMAESGYHAFMRSNQQVVFGHEFCGEVVDYGPGTRRTPRRGTPVVAMPLLRRGNKEVHGIGLSTMAPGAYAERLVVEQSLTFPVPNGLAPEIAALTEPMAVGWHAVRRGEVGKGDVAIVIGCGPIGLAVICMLKSRGVHTVIASDFSPGRRALATACGADSVVDPVQDSPYAVAAGLGQGNRHLQSILDAFDLAVGTVERLQRLRLPWWHLWRAAEAAGAATPKRPVIFECVGVPGIIDGIIASAPLFSRVVVVGVCMGSDHIRPAMAINKEINLRFVLGYTPLEFRDTLHMLADGKVNAAPLITGTVGLPGVAAAFDALGDPEAHAKIMIDPKSNAASPQPFRVE
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv3726? Email the maintainer — the message is pre-filled with this gene's details.