atpF Family assigned · medium auto-curated

H37Rv Rv1306 · MTBC0 mtbc0_001398 · 171 aa · 1470360–1470875 (+) · RefSeq NP_215822.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ATP synthase subunit B
MTBC0 PGAP re-annotationF0F1 ATP synthase subunit B
Revised (this work)F0F1 ATP synthase subunit B. Pfam: ATP-synt_B (PF00430.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPV5 SwissProt · reviewed · Evidence at protein level
UniProt nameATP synthase subunit b
Curated functionF(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation..; FUNCTION: Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred nameatpF
eggNOG descriptionComponent of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0)
Orthologous groupCOG0711
KEGG orthology K02109
KEGG pathways map00190, map00195, map01100
KEGG modules M00157
Gene Ontology (16) GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0005887, GO:0008150, GO:0016020, GO:0016021, GO:0030312, GO:0031224, GO:0031226, GO:0040007 +4 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ATP-synt_BPF00430.24 1.8e-3230–160 ATP synthase B/B' CF(0)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: atpD (ATP synthase subunit beta), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1310 atpD ATP synthase subunit beta 999 1000 ctx neighborhood:619 coexpression:955 experimental:997 database:900 textmining:799
Rv1308 atpA ATP synthase subunit alpha 999 1000 ctx neighborhood:817 coexpression:925 experimental:997 database:900 textmining:854
Rv1309 atpG ATP synthase subunit gamma 999 1000 ctx neighborhood:817 coexpression:954 experimental:997 database:900 textmining:823
Rv1304 atpB ATP synthase subunit A 999 1000 ctx neighborhood:778 coexpression:949 experimental:997 database:900 textmining:851
Rv1307 atpH ATP synthase subunit b/delta 999 1000 ctx neighborhood:882 coexpression:949 experimental:997 database:900
Rv1305 atpE ATP synthase subunit C 999 1000 ctx neighborhood:836 coexpression:960 experimental:997 database:900 textmining:648
Rv1311 atpC ATP synthase subunit epsilon 999 1000 ctx neighborhood:730 coexpression:943 experimental:870 database:900 textmining:812
Rv1303 hyp hypothetical protein 955 955 ctx neighborhood:778 coexpression:731
Rv3628 ppa inorganic pyrophosphatase 950 945 coexpression:472 database:900
Rv1507c hyp hypothetical protein 930 924 coexpression:670 experimental:773
Rv2196 qcrB ubiquinol-cytochrome C reductase cytochrome subunit B 938 879 coexpression:879 textmining:517
Rv2195 qcrA ubiquinol-cytochrome C reductase rieske iron-sulfur subunit 889 817 coexpression:817 textmining:419
Rv0682 rpsL 30S ribosomal protein S12 887 776 coexpression:774 textmining:519
Rv0701 rplC 50S ribosomal protein L3 790 760 coexpression:725
Rv0710 rpsQ 30S ribosomal protein S17 798 743 coexpression:708

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ATP synthase subunit B
  • MTBC0 PGAP product: F0F1 ATP synthase subunit B
  • Pfam (hmmscan --cut_ga): ATP-synt_B PF00430.24 (E=2e-32)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215822.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ATP-synt_B (PF00430.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0711
  • Curated reference: UniProt P9WPV5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 125 functional partner(s); context anchor atpD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001398|Rv1306|atpF
MGEVSAIVLAASQAAEEGGESSNFLIPNGTFFVVLAIFLVVLAVIGTFVVPPILKVLRERDAMVAKTLADNKKSDEQFAAAQADYDEAMTEARVQASSLRDNARADGRKVIEDARVRAEQQVASTLQTAHEQLKRERDAVELDLRAHVGTMSATLASRILGVDLTASAATR