panC Resolved · high auto-curated
H37Rv Rv3602c · MTBC0 mtbc0_003820 ·
309 aa ·
4067985–4068914 MTBC0
(-) ·
RefSeq NP_218119.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | pantothenate synthetase |
|---|---|
| MTBC0 PGAP re-annotation | pantoate--beta-alanine ligase |
| Revised (this work) | Pantoate--beta-alanine ligase. Pfam: Pantoate_ligase (PF02569.22). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 32 publications
32 TB publications mention this gene. 32 publication(s) discuss this gene (30 in a M. tuberculosis context, 2 in other mycobacteria — M. smegmatis (2)).
| Publication | Date |
|---|---|
| A neutral multivalent AIE-TICT scaffold: An off-on, wash-free fluorogenic strategy for biosensing glycan-protein interactions in live cells and mycobacteria. doi:10.1016/j.aca.2025.344604 | 2025 |
| Ultra-performance Liquid Chromatography Coupled with Quadrupole Time-of-Flight Mass Spectrometry-Based Profiling and Evaluation of Antioxidant, Antityrosinase, Antimicrobial and Antiproliferative Activities of Eulophia nuda Lindl.: A Medicinal Orchid. doi:10.1002/cbdv.202402833 | 2025 |
| First Indonesian report of WGS-based MTBC L3 discovery. doi:10.1186/s13104-024-06825-5 | 2024 |
| Identification of the Seaweed Metabolites as Potential Anti-tubercular Agents Against Human Pantothenate synthetase: An In Silico Approach. doi:10.1007/s00284-023-03422-w | 2023 |
| Pantothenate biosynthesis in Toxoplasma gondii tachyzoites is not a drug target. doi:10.1016/j.ijpddr.2023.03.003 | 2023 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | Rv3603c (Rv3603c, - strand) |
|---|---|
| Overlap | 4 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Post-translational modifications
1 reported modified residue(s):
N-acetylthreonine @2.
Experimentally reported post-translational modification(s). A phosphosite indicates the protein is expressed and is a substrate of the M. tuberculosis Ser/Thr/Tyr kinase signalling network — a regulatory context, NOT a molecular function. Source: UniProt (Modified residue features; PTM sites curated from the M. tuberculosis literature).
CRISPRi vulnerability
Vulnerability index -3.93 (95% CI -4.22 to -3.64). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in pantothenate biosynthesis [catalytic activity: ATP + (R)-pantoate + beta-alanine = AMP + pyrophosphate + (R)-pantothenate]. |
|---|---|
| Mycobrowser EC |
6.3.2.1
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3632c
· 100.0% identity |
|---|---|
| M. leprae |
ML0230
· 79.8% identity |
| M. marinum |
MMAR_5105
· 79.8% identity |
| M. smegmatis |
MSMEG_6097
· 64.3% identity |
| M. orygis |
RJtmp_003709
· 100.0% identity |
| M. abscessus |
MAB_0541
· 62.1% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WIL5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Pantothenate synthetase |
| EC (curated) |
EC 6.3.2.1
|
| Curated function | Catalyzes the condensation of pantoate with beta-alanine in an ATP-dependent reaction via a pantoyl-adenylate intermediate. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | panC |
| eggNOG description | Catalyzes the condensation of pantoate with beta-alanine in an ATP-dependent reaction via a pantoyl-adenylate intermediate |
| Orthologous group | COG0414 |
| EC number |
EC 6.3.2.1
|
| KEGG orthology |
K01918
|
| KEGG pathways |
map00410, map00770, map01100, map01110
|
| KEGG modules |
M00119
|
| Gene Ontology (84) |
GO:0000166, GO:0000287, GO:0001505, GO:0003674, GO:0003824, GO:0004592, GO:0005488, GO:0005524, GO:0005575, GO:0005622, GO:0005623, GO:0005737 +72 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.096 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 79.0%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 11/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 57.6% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 13 in the ORF — 13 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.000, mean read count 0. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain validated drug target
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | panC-Flag-DAS-tetON-18 (TetON promoter 18) |
|---|---|
| Baseline knockdown fitness | 3.232 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
| Drug-target cross-reference | annotated mechanism-of-action target PanC: 3 reference compound(s) phenocopy its inhibition — chemically-validated druggable target |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 66.9 ppm · rank 1564/3519 (55.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 309 aa |
|---|---|
| Molecular weight | 32.7 kDa |
| Theoretical pI | 5.7 |
| GRAVY | 0.173 (hydrophobic) |
| Aliphatic index | 104.3 |
| Aromaticity | 0.055 |
| Instability index | 27.3 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Pantoate_ligase | PF02569.22 | 7.0e-94 | 18–283 | Pantoate-beta-alanine ligase |
Experimental structures (Protein Data Bank) 40 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
4g5f |
X-ray diffraction | 2.33 Å | 100% |
3iub |
X-ray diffraction | 1.5 Å | 97% |
3cov |
X-ray diffraction | 1.5 Å | 97% |
2a84 |
X-ray diffraction | 1.55 Å | 97% |
1mop |
X-ray diffraction | 1.6 Å | 97% |
1n2e |
X-ray diffraction | 1.6 Å | 97% |
3imc |
X-ray diffraction | 1.6 Å | 97% |
4fzj |
X-ray diffraction | 1.63 Å | 97% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (40 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3ioe-assembly1_B |
1.00 | 0.99 | 1.1e-55 sig | 3ioe-assembly1_B Crystal Structure of Mycobacterium Tuberculosis Pantothenate Synthetase at 1.95 Ang resolution in complex with 5'-deoxy-5'-((R)-3,4-dihydroxybutylthio)-adenosine |
4ddk-assembly1_B |
1.00 | 0.99 | 1.3e-55 sig | 4ddk-assembly1_B Pantothenate synthetase in complex with 1,3-benzodioxole-5-carboxylic acid |
1mop-assembly1_B |
1.00 | 0.99 | 2.2e-55 sig | 1mop-assembly1_B Crystal Structure of a Pantothenate Synthetase from M. tuberculosis |
3iub-assembly1_B |
1.00 | 0.99 | 2.6e-55 sig | 3iub-assembly1_B Crystal structure of pantothenate synthetase from Mycobacterium tuberculosis in complex with 5-Methoxy-N-(5-methylpyridin-2-ylsulfonyl)-1H-indole-2-carboxamide |
3ivc-assembly1_A |
1.00 | 0.98 | 8.0e-56 sig | 3ivc-assembly1_A Crystal structure of pantothenate synthetase in complex with 2-(2-((benzofuran-2-ylmethoxy)carbonyl)-5-methoxy-1H-indol-1-yl)acetic acid |
Foldseek search of the AlphaFold DB model (mean pLDDT 92.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 4
| Upstream (5' on genome) | panD (- strand, -1 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3603c (- strand, -4 bp gap) |
| Predicted operon |
Rv3600c · panD · panC · Rv3603c
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (3 TF) |
Rv0324 (activates) · Rv1353c (represses) · Rv3736 (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: panD (aspartate 1-decarboxylase), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3601c panD exp |
aspartate 1-decarboxylase | 999 | 1000 ctx | neighborhood:882 cooccurence:678 coexpression:967 database:900 textmining:942 |
Rv3600c coaX exp |
type III pantothenate kinase | 999 | 997 ctx | neighborhood:882 coexpression:759 database:900 textmining:713 |
Rv2225 panB |
3-methyl-2-oxobutanoate hydroxymethyltransferase | 999 | 995 ctx | fusion:811 cooccurence:774 coexpression:859 textmining:917 |
Rv3603c hyp |
hypothetical protein | 997 | 986 ctx | neighborhood:881 fusion:795 cooccurence:471 textmining:806 |
Rv3432c gadB exp |
glutamate decarboxylase GadB | 946 | 943 | coexpression:421 database:900 |
Rv2573 exp |
2-dehydropantoate 2-reductase | 933 | 913 | database:900 |
Rv1712 cmk |
cytidylate kinase | 908 | 908 ctx | fusion:900 |
Rv3293 pcd exp |
piperideine-6-carboxylic acid dehydrogenase | 905 | 901 | database:900 |
Rv1092c coaA exp |
pantothenate kinase | 963 | 900 | database:900 textmining:650 |
Rv2589 gabT exp |
4-aminobutyrate aminotransferase | 905 | 900 | database:900 |
Rv0223c exp |
aldehyde dehydrogenase | 904 | 900 | database:900 |
Rv0147 exp |
aldehyde dehydrogenase | 903 | 900 | database:900 |
Rv0768 aldA exp |
aldehyde dehydrogenase AldA | 903 | 900 | database:900 |
Rv1391 dfp exp |
bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase | 927 | 866 | database:800 textmining:480 |
Rv3598c lysS |
lysine--tRNA ligase | 881 | 787 ctx | neighborhood:773 textmining:465 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: pantothenate synthetase
- MTBC0 PGAP product: pantoate--beta-alanine ligase
- Pfam (hmmscan --cut_ga): Pantoate_ligase PF02569.22 (E=7e-94)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218119.1)
- Domains: Pfam-A via hmmscan --cut_ga — Pantoate_ligase (PF02569.22)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0414 - Curated reference: UniProt P9WIL5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.8)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
52 functional partner(s); context anchor
panD - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003820|Rv3602c|panC MTIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGEDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFAGTDRPDGYRAILESHWRN
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for panC? Email the maintainer — the message is pre-filled with this gene's details.