Rv1139c Family assigned · medium auto-curated
H37Rv Rv1139c · MTBC0 mtbc0_001224 ·
166 aa ·
1274925–1275425 MTBC0
(-) ·
RefSeq NP_215655.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | isoprenylcysteine carboxyl methyltransferase family protein |
| Revised (this work) | Isoprenylcysteine carboxyl methyltransferase family protein. Pfam: ICMT (PF04140.20), PEMT (PF04191.19). |
| Functional category (TubercuList) | cell wall and cell processes |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
Found under: H37Rv (2).
2 TB publications mention this gene. 2 publication(s) mention this gene (title/abstract), verified against the text. The atlas states the function; these are the primary sources that discuss it.
| Publication | Date |
|---|---|
| Analysis of differentially expressed proteins in late-stationary growth phase of Mycobacterium tuberculosis H37Rv. doi:10.1002/bab.1137 | 2014 |
| The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. doi:10.1128/JB.187.20.7062-7071.2005 | 2005 |
This layer CITES the literature, it does not change the verdict or the function. A gene may be heavily studied (as an antigen, a resistance determinant, a drug target) while its molecular function is settled elsewhere in the fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | srsC (Rv1138c, - strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 1.29 (95% CI -0.33 to 3.90). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Function unknown |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1171c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_4314
· 84.1% identity |
| M. smegmatis |
MSMEG_0809
· 64.8% identity |
| M. orygis |
RJtmp_001201
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O06539
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved hypothetical membrane protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Isoprenylcysteine carboxyl methyltransferase |
| Orthologous group | COG1755 |
| KEGG orthology |
K16168
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 50/53 (94%) · mean identity 80.6%
· 4/4 closest MTBAP relatives conserved across the genus (present in 50/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 2/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 50.7% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 13 in the ORF — 0 in the essential state, 0 growth-defect, 13 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 135.307692308. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 6 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 3.62 ppm · rank 3046/3519 (13.5th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (5 TM helixes) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 5 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 166 aa |
|---|---|
| Molecular weight | 19.0 kDa |
| Theoretical pI | 10.67 |
| GRAVY | 0.556 (hydrophobic) |
| Aliphatic index | 122.7 |
| Aromaticity | 0.127 |
| Instability index | 45.2 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ICMT | PF04140.20 | 1.0e-26 | 73–163 | Isoprenylcysteine carboxyl methyltransferase (ICMT) family |
PEMT | PF04191.19 | 8.8e-08 | 75–163 | Phospholipid methyltransferase |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4a2n-assembly1_B |
1.00 | 0.70 | 1.3e-03 sig | 4a2n-assembly1_B Crystal Structure of Ma-ICMT |
5v7p-assembly1_A |
1.00 | 0.72 | 1.6e-03 sig | 5v7p-assembly1_A Atomic structure of the eukaryotic intramembrane Ras methyltransferase ICMT (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody |
5vg9-assembly1_A |
1.00 | 0.72 | 3.5e-03 sig | 5vg9-assembly1_A Structure of the eukaryotic intramembrane Ras methyltransferase ICMT (isoprenylcysteine carboxyl methyltransferase) without a monobody |
Foldseek search of the AlphaFold DB model (mean pLDDT 92.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv1138c (- strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1140 (+ strand, 361 bp gap) |
| Predicted operon |
Rv1138c · Rv1139c
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
Rv1404 (represses) · Rv2034 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv1138c (oxidoreductase), high confidence from genomic context alone (score 979 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1138c |
oxidoreductase | 988 | 979 ctx | neighborhood:881 cooccurence:767 textmining:489 |
Rv1660 pks10 |
chalcone synthase | 926 | 901 ctx | cooccurence:774 coexpression:532 |
Rv1665 pks11 |
chalcone synthase | 904 | 871 ctx | cooccurence:774 |
Rv1372 pks18 |
alpha-pyrone synthesis polyketide synthase-like protein | 875 | 832 ctx | cooccurence:702 coexpression:400 |
Rv1137c |
Hypothetical protein; Rv1137c, (MTCI65.04c), len: 122 aa. Hypothetical unknown protein. | 767 | 767 ctx | neighborhood:737 |
Rv2638 hyp |
hypothetical protein | 606 | 215 | textmining:519 |
Rv2161c hyp |
hypothetical protein | 805 | 55 | textmining:803 |
Rv2781c |
oxidoreductase | 815 | 54 | textmining:813 |
Rv0952 sucD |
succinyl-CoA ligase subunit alpha | 437 | 50 | textmining:432 |
Rv3224 |
iron-regulated short-chain dehydrogenase/reductase | 657 | 47 | textmining:655 |
Rv3572 hyp |
hypothetical protein | 656 | 47 | textmining:654 |
Rv2192c trpD |
anthranilate phosphoribosyltransferase | 523 | 47 | textmining:520 |
Rv2643 arsC |
arsenic-transport integral membrane protein ArsC | 480 | 46 | textmining:478 |
Rv3089 fadD13 |
long chain-fatty-acid--CoA ligase FadD13 | 431 | 44 | textmining:430 |
Rv0820 phoT |
phosphate ABC transporter ATP-binding protein PhoT | 514 | 42 | textmining:514 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: isoprenylcysteine carboxyl methyltransferase family protein
- Pfam (hmmscan --cut_ga): ICMT PF04140.20 (E=1e-26), PEMT PF04191.19 (E=9e-08)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215655.1)
- Domains: Pfam-A via hmmscan --cut_ga — ICMT (PF04140.20), PEMT (PF04191.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1755 - Curated reference: UniProt O06539 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
18 functional partner(s); context anchor
Rv1138c - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001224|Rv1139c| MYYLLILAVVFERLAELVVAQRNARWSFAQGGKEFGRPHYVVMVILHTALLLGCVVEPWALHRPFIPWLGWPMLAVVVASQGLRWWCVKSLGKRWNTRVIVLPHATLVRRGPYRWMRHPNYVAVVAEGFALPLVHTAWLTALVFTLANATLLTVRLRVENSVLGYI
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv1139c? Email the maintainer — the message is pre-filled with this gene's details.