Rv1139c Family assigned · medium auto-curated

H37Rv Rv1139c · MTBC0 mtbc0_001224 · 166 aa · 1274925–1275425 (-) · RefSeq NP_215655.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationisoprenylcysteine carboxyl methyltransferase family protein
Revised (this work)Isoprenylcysteine carboxyl methyltransferase family protein. Pfam: ICMT (PF04140.20), PEMT (PF04191.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06539 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved hypothetical membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionIsoprenylcysteine carboxyl methyltransferase
Orthologous groupCOG1755
KEGG orthology K16168

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ICMTPF04140.20 1.0e-2673–163 Isoprenylcysteine carboxyl methyltransferase (ICMT) family
PEMTPF04191.19 8.8e-0875–163 Phospholipid methyltransferase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1138c (oxidoreductase), high confidence from genomic context alone (score 979 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1138c oxidoreductase 988 979 ctx neighborhood:881 cooccurence:767 textmining:489
Rv1660 pks10 chalcone synthase 926 901 ctx cooccurence:774 coexpression:532
Rv1665 pks11 chalcone synthase 904 871 ctx cooccurence:774
Rv1372 pks18 alpha-pyrone synthesis polyketide synthase-like protein 875 832 ctx cooccurence:702 coexpression:400
Rv1137c Hypothetical protein; Rv1137c, (MTCI65.04c), len: 122 aa. Hypothetical unknown protein. 767 767 ctx neighborhood:737
Rv2638 hyp hypothetical protein 606 215 textmining:519
Rv2161c hyp hypothetical protein 805 55 textmining:803
Rv2781c oxidoreductase 815 54 textmining:813
Rv0952 sucD succinyl-CoA ligase subunit alpha 437 50 textmining:432
Rv3224 iron-regulated short-chain dehydrogenase/reductase 657 47 textmining:655
Rv3572 hyp hypothetical protein 656 47 textmining:654
Rv2192c trpD anthranilate phosphoribosyltransferase 523 47 textmining:520
Rv2643 arsC arsenic-transport integral membrane protein ArsC 480 46 textmining:478
Rv3089 fadD13 long chain-fatty-acid--CoA ligase FadD13 431 44 textmining:430
Rv0820 phoT phosphate ABC transporter ATP-binding protein PhoT 514 42 textmining:514

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: isoprenylcysteine carboxyl methyltransferase family protein
  • Pfam (hmmscan --cut_ga): ICMT PF04140.20 (E=1e-26), PEMT PF04191.19 (E=9e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215655.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ICMT (PF04140.20), PEMT (PF04191.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1755
  • Curated reference: UniProt O06539 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor Rv1138c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001224|Rv1139c|
MYYLLILAVVFERLAELVVAQRNARWSFAQGGKEFGRPHYVVMVILHTALLLGCVVEPWALHRPFIPWLGWPMLAVVVASQGLRWWCVKSLGKRWNTRVIVLPHATLVRRGPYRWMRHPNYVAVVAEGFALPLVHTAWLTALVFTLANATLLTVRLRVENSVLGYI