Rv2781c Resolved · high auto-curated

H37Rv Rv2781c · MTBC0 mtbc0_002960 · 344 aa · 3110365–3111399 (-) · RefSeq NP_217297.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)oxidoreductase
MTBC0 PGAP re-annotationnitronate monooxygenase
Revised (this work)Nitronate monooxygenase. Pfam: NMO (PF03060.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6X5C5 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable nitronate monooxygenase
Curated functionNitronate monooxygenase that uses molecular oxygen to catalyze the oxidative denitrification of alkyl nitronates. Acts on propionate 3-nitronate (P3N), the presumed physiological substrate. Probably functions in the detoxification of P3N, a metabolic poison produced by plants and fungi as a defense mechanism.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred nameyrpB
eggNOG description2-nitropropane dioxygenase
Orthologous groupCOG2070
EC number EC 1.13.12.16
KEGG orthology K00459
KEGG pathways map00910

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.365 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NMOPF03060.22 1.4e-1257–339 Nitronate monooxygenase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pepR (zinc protease), high confidence from genomic context alone (score 850 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0021c hyp hypothetical protein 929 930 database:900
Rv0267 narU nitrite extrusion protein NarU 909 909 database:900
Rv0261c narK3 nitrate/nitrite transporter 909 908 database:900
Rv1737c narK2 nitrate/nitrite transporter 909 908 database:900
Rv2329c narK1 nitrate/nitrite transporter 908 908 database:900
Rv1164 narI nitrate reductase subunit gamma 903 904 database:900
Rv1162 narH nitrate reductase subunit beta 902 903 database:900
Rv1161 narG nitrate reductase subunit alpha 901 902 database:900
Rv1736c narX nitrate reductase-like protein NarX 901 901 database:900
Rv0252 nirB nitrite reductase large subunit NirB 900 900 database:900
Rv0253 nirD nitrite reductase small subunit NirD 900 900 database:900
Rv2782c pepR zinc protease 850 850 ctx neighborhood:802
Rv2783c gpsI bifunctional guanosine pentaphosphate synthetase/polyribonucleotide nucleotidyltransferase 807 807 ctx neighborhood:802
Rv2524c fas fatty acid synthase 782 748 coexpression:712
Rv2784c lppU lipoprotein LppU 679 678 ctx neighborhood:675

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: oxidoreductase
  • MTBC0 PGAP product: nitronate monooxygenase
  • Pfam (hmmscan --cut_ga): NMO PF03060.22 (E=1e-125)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217297.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NMO (PF03060.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2070
  • Curated reference: UniProt I6X5C5 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 45 functional partner(s); context anchor pepR
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002960|Rv2781c|
MVLGFWDIAVPIVGAPMAGGPSTPALAAAVSNAGGLGFVAGGYLSADRLADDIAAARAATTGPIGANLFVPQPSVADWAQLEYYADELEEVAEYYHTEVGQPVYGDDDDWVRKLEVVADVRPEVVSFTFGAPPPDVVQRLSALGLLVSITVTSVYEAGVAIAAGADSLVVQGPAAGGHRGTFAPDMEPGTESLHQLLDRIGSAHDVPLVAAGGLGTAEDVAAVLRRGAIAAQVGTALLLADEAGTNAAHRAALKNPEFDATLVTRAFSGRYARGLANNFTRLLDHVAPLGYPEVHQMTKPIRAAAVQADDPHGTNLWAGSAHRKTRPGPAADIIASLTPDVCSA