fhaB Family assigned · medium auto-curated
H37Rv Rv0019c · MTBC0 mtbc0_000023 ·
155 aa · 23270–23737 (-) ·
RefSeq NP_214533.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | FHA domain-containing protein FhaB |
|---|---|
| MTBC0 PGAP re-annotation | FHA domain-containing protein |
| Revised (this work) | FHA domain-containing protein. Pfam: Yop-YscD_cpl (PF16697.11), FHA (PF00498.32). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WJB5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | FHA domain-containing protein FhaB |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
T Signal transduction mechanisms
|
|---|---|
| Preferred name | fhaB |
| eggNOG description | FHA domain-containing protein |
| Orthologous group | COG1716 |
| Gene Ontology (21) |
GO:0005575, GO:0005576, GO:0005623, GO:0005886, GO:0006950, GO:0006979, GO:0008150, GO:0009987, GO:0016020, GO:0040007, GO:0044110, GO:0044116 +9 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.187 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Yop-YscD_cpl | PF16697.11 | 4.2e-15 | 66–154 | Inner membrane component of T3SS, cytoplasmic domain |
FHA | PF00498.32 | 1.5e-16 | 83–147 | FHA domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: pknB (serine/threonine-protein kinase PknB), high confidence from genomic context alone (score 959 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1248c kgd |
multifunctional 2-oxoglutarate dehydrogenase E1 component /2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase | 985 | 984 | experimental:984 |
Rv0014c pknB |
serine/threonine-protein kinase PknB | 991 | 959 ctx | neighborhood:780 experimental:711 textmining:798 |
Rv0015c pknA |
serine/threonine-protein kinase PknA | 979 | 901 ctx | neighborhood:780 textmining:798 |
Rv0018c pstP |
phosphoserine/threonine phosphatase PstP | 988 | 863 ctx | neighborhood:780 textmining:916 |
Rv0020c fhaA |
FHA domain-containing protein FhaA | 981 | 851 ctx | neighborhood:597 cooccurence:625 textmining:879 |
Rv0017c rodA |
cell division protein RodA | 933 | 851 ctx | neighborhood:780 textmining:574 |
Rv0016c pbpA |
penicillin-binding protein PbpA | 967 | 835 ctx | neighborhood:780 textmining:810 |
Rv1364c |
sigma factor regulatory protein | 688 | 687 | coexpression:647 |
Rv1278 hyp |
hypothetical protein | 643 | 630 | database:579 |
Rv1277 hyp |
hypothetical protein | 643 | 630 | database:579 |
Rv3724B cut5b |
Rv3724B, (MTV025.072), len: 187 aa. Probable cut5b,truncated cutinase, similar to C-terminal end of others e.g. Q9XB09|RVD2-RV1758 protein ( | 597 | 598 | database:530 |
Rv3451 cut3 |
cutinase | 596 | 596 | database:530 |
Rv3724A cut5a |
Rv3724A, (MTV025.072), len: 80 aa. Probable cut5a,truncated cutinase precursor, similar to N-terminal end of others e.g. Q9KK87 serine ester | 595 | 596 | database:530 |
Rv3483c hyp |
hypothetical protein | 595 | 595 | database:530 |
Rv1758 cut1 |
cutinase | 593 | 594 | database:530 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: FHA domain-containing protein FhaB
- MTBC0 PGAP product: FHA domain-containing protein
- Pfam (hmmscan --cut_ga): Yop-YscD_cpl PF16697.11 (E=4e-15), FHA PF00498.32 (E=1e-16)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214533.1)
- Domains: Pfam-A via hmmscan --cut_ga — Yop-YscD_cpl (PF16697.11), FHA (PF00498.32)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1716 - Curated reference: UniProt P9WJB5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
51 functional partner(s); context anchor
pknB - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000023|Rv0019c|fhaB MQGLVLQLTRAGFLMLLWVFIWSVLRILKTDIYAPTGAVMMRRGLALRGTLLGARQRRHAARYLVVTEGALTGARITLSEQPVLIGRADDSTLVLTDDYASTRHARLSMRGSEWYVEDLGSTNGTYLDRAKVTTAVRVPIGTPVRIGKTAIELRP