fhaB Family assigned · medium auto-curated

H37Rv Rv0019c · MTBC0 mtbc0_000023 · 155 aa · 23270–23737 (-) · RefSeq NP_214533.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)FHA domain-containing protein FhaB
MTBC0 PGAP re-annotationFHA domain-containing protein
Revised (this work)FHA domain-containing protein. Pfam: Yop-YscD_cpl (PF16697.11), FHA (PF00498.32).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJB5 SwissProt · reviewed · Evidence at protein level
UniProt nameFHA domain-containing protein FhaB

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
Preferred namefhaB
eggNOG descriptionFHA domain-containing protein
Orthologous groupCOG1716
Gene Ontology (21) GO:0005575, GO:0005576, GO:0005623, GO:0005886, GO:0006950, GO:0006979, GO:0008150, GO:0009987, GO:0016020, GO:0040007, GO:0044110, GO:0044116 +9 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.187 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Yop-YscD_cplPF16697.11 4.2e-1566–154 Inner membrane component of T3SS, cytoplasmic domain
FHAPF00498.32 1.5e-1683–147 FHA domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pknB (serine/threonine-protein kinase PknB), high confidence from genomic context alone (score 959 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1248c kgd multifunctional 2-oxoglutarate dehydrogenase E1 component /2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase 985 984 experimental:984
Rv0014c pknB serine/threonine-protein kinase PknB 991 959 ctx neighborhood:780 experimental:711 textmining:798
Rv0015c pknA serine/threonine-protein kinase PknA 979 901 ctx neighborhood:780 textmining:798
Rv0018c pstP phosphoserine/threonine phosphatase PstP 988 863 ctx neighborhood:780 textmining:916
Rv0020c fhaA FHA domain-containing protein FhaA 981 851 ctx neighborhood:597 cooccurence:625 textmining:879
Rv0017c rodA cell division protein RodA 933 851 ctx neighborhood:780 textmining:574
Rv0016c pbpA penicillin-binding protein PbpA 967 835 ctx neighborhood:780 textmining:810
Rv1364c sigma factor regulatory protein 688 687 coexpression:647
Rv1278 hyp hypothetical protein 643 630 database:579
Rv1277 hyp hypothetical protein 643 630 database:579
Rv3724B cut5b Rv3724B, (MTV025.072), len: 187 aa. Probable cut5b,truncated cutinase, similar to C-terminal end of others e.g. Q9XB09|RVD2-RV1758 protein ( 597 598 database:530
Rv3451 cut3 cutinase 596 596 database:530
Rv3724A cut5a Rv3724A, (MTV025.072), len: 80 aa. Probable cut5a,truncated cutinase precursor, similar to N-terminal end of others e.g. Q9KK87 serine ester 595 596 database:530
Rv3483c hyp hypothetical protein 595 595 database:530
Rv1758 cut1 cutinase 593 594 database:530

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: FHA domain-containing protein FhaB
  • MTBC0 PGAP product: FHA domain-containing protein
  • Pfam (hmmscan --cut_ga): Yop-YscD_cpl PF16697.11 (E=4e-15), FHA PF00498.32 (E=1e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214533.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Yop-YscD_cpl (PF16697.11), FHA (PF00498.32)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1716
  • Curated reference: UniProt P9WJB5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 51 functional partner(s); context anchor pknB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000023|Rv0019c|fhaB
MQGLVLQLTRAGFLMLLWVFIWSVLRILKTDIYAPTGAVMMRRGLALRGTLLGARQRRHAARYLVVTEGALTGARITLSEQPVLIGRADDSTLVLTDDYASTRHARLSMRGSEWYVEDLGSTNGTYLDRAKVTTAVRVPIGTPVRIGKTAIELRP