esxT Family assigned · medium auto-curated

H37Rv Rv3444c · MTBC0 mtbc0_003663 · 100 aa · 3888509–3888811 MTBC0 (-) · RefSeq NP_217961.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand gadB (Rv3432c) — requalified: glutamate decarboxylase gadB Rv3433c (Rv3433c) — requalified: NAD(P)H-hydrate dehydratase Rv3433c Rv3434c (Rv3434c) — family_assigned: rhomboid-like protein Rv3435c (Rv3435c) — family_assigned: DUF4436 domain-containing protein Rv3435c glmS (Rv3436c) — requalified: glutamine--fructose-6-phosphate transaminase (isomerizing) glmS Rv3437 (Rv3437) — dark: DUF2510 domain-containing protein Rv3438 (Rv3438) — family_assigned: alpha/beta hydrolase Rv3438 Rv3439c (Rv3439c) — family_assigned: hypothetical protein Rv3439c Rv3440c (Rv3440c) — family_assigned: hypothetical protein mrsA (Rv3441c) — requalified: phosphoglucosamine mutase mrsA rpsI (Rv3442c) — requalified: 30S ribosomal protein S9 rplM (Rv3443c) — requalified: 50S ribosomal protein L13 esxT (Rv3444c) — family_assigned: WXG100 family type VII secretion target esxU (Rv3445c) — requalified: type VII secretion system ESX-4 protein EsxU Rv3446c (Rv3446c) — family_assigned: type VII secretion-associated protein Rv3446c eccC4 (Rv3447c) — family_assigned: type VII secretion system ESX-4 FtsK/SpoIIIE family ATPase E eccC4 eccD4 (Rv3448) — family_assigned: type VII secretion system ESX-4 subunit EccD4 eccD4 mycP4 (Rv3449) — requalified: type VII secretion system ESX-4 serine protease mycosin MycP mycP4 eccB4 (Rv3450c) — family_assigned: type VII secretion system ESX-4 subunit EccB4 eccB4 cut3 (Rv3451) — family_assigned: cutinase family protein cut4 (Rv3452) — requalified: cutinase Cut4 3 880 kb 3 884 kb 3 888 kb 3 892 kb 3 896 kb 3 900 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ESAT-6 like protein EsxT
MTBC0 PGAP re-annotationWXG100 family type VII secretion target
Revised (this work)WXG100 family type VII secretion target. Pfam: WXG100 (PF06013.19).
Functional category (TubercuList)cell wall and cell processes

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 8 publications

8 TB publications mention this gene. 8 publication(s) discuss this gene (7 in a M. tuberculosis context, 3 in other mycobacteria — M. abscessus (1), M. leprae (1), M. marinum (1), M. smegmatis (1)).

Most recent 5 of 8.
PublicationDate
Control of Mycobacterium tuberculosis protein secretion by ESX-4 and the outer membrane EsxUT-EsxEF complex. doi:10.1038/s41467-025-65061-y 2025
Master control of protein secretion by Mycobacterium tuberculosis. doi:10.1101/2025.03.13.643117 2025
The ESX-4 substrates, EsxU and EsxT, modulate Mycobacterium abscessus fitness. doi:10.1371/journal.ppat.1010771 2022
Crosstalk between the ancestral type VII secretion system ESX-4 and other T7SS in Mycobacterium marinum. doi:10.1016/j.isci.2021.103585 2022
Biophysical and immunological characterization of the ESX-4 system ESAT-6 family proteins Rv3444c and Rv3445c from Mycobacterium tuberculosis H37Rv. doi:10.1016/j.tube.2018.02.002 2018

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 0.87 (95% CI -0.77 to 3.36). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionFunction unknown

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3474c · 100.0% identity
M. leprae ML0363 · 71.2% identity
M. marinum MMAR_1105 · 80.4% identity
M. smegmatis MSMEG_1539 · 72.0% identity
M. orygis RJtmp_003553 · 99.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt I6YC53 SwissProt · reviewed · Evidence at protein level
UniProt nameESAT-6-like protein EsxT
Curated functionInduces apoptosis of host cells via activation of NF-kappa-B.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred nameesxT
eggNOG descriptionBelongs to the WXG100 family
Orthologous groupCOG4842
KEGG orthology K14956
KEGG pathways map05152

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.154 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Mycobacterium

M. canettii dN/dS (deep-divergence selection) 0.155 (low power) · 3 consensus substitution(s)
low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 52/53 (98%) · mean identity 81.1% · 4/4 closest MTBAP relatives
conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria

present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 5 in the ORF — 0 in the essential state, 0 growth-defect, 5 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 215.8. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 5 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 5 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 3 of 16 independent MS datasets
Integrated abundance0.27 ppm · rank 3411/3519 (3.1th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length100 aa
Molecular weight11.1 kDa
Theoretical pI5.89
GRAVY-0.338 (hydrophilic)
Aliphatic index89.2
Aromaticity0.08
Instability index50.6 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
WXG100PF06013.19 2.1e-1018–92 Proteins of 100 residues with WXG

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)rplM (- strand, 233 bp gap)
Downstream (3' on genome)esxU (- strand, 20 bp gap)
Predicted operon esxT · esxU

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) csoR (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: esxU (ESAT-6 like protein EsxU), high confidence from genomic context alone (score 974 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3445c esxU ESAT-6 like protein EsxU 998 974 ctx neighborhood:857 coexpression:827 textmining:948
Rv3447c eccC4 ESX-4 secretion system protein EccC4 876 863 ctx neighborhood:792
Rv3446c hyp hypothetical protein 891 857 ctx neighborhood:792
Rv3449 mycP4 membrane-anchored mycosin 809 778 ctx neighborhood:720
Rv3448 eccD4 ESX-4 secretion system protein EccD4 781 762 ctx neighborhood:720
Rv3443c rplM 50S ribosomal protein L13 730 730 ctx neighborhood:728
Rv3244c lpqB lipoprotein LpqB 670 671 ctx cooccurence:659
Rv0129c fbpC diacylglycerol acyltransferase/mycolyltransferase Ag85C 690 651 ctx cooccurence:650
Rv2488c LuxR family transcriptional regulator 651 651 coexpression:651
Rv2743c hyp hypothetical protein 618 618 ctx cooccurence:617
Rv3903c cpnT hyp hypothetical protein 620 606 coexpression:580
Rv0756c hyp hypothetical protein 594 594 ctx cooccurence:587
Rv0996 transmembrane protein 588 588 ctx cooccurence:587
Rv3803c fbpD MPT51/MPB51 antigen 582 582 ctx cooccurence:581
Rv3668c protease 572 572 ctx cooccurence:572

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ESAT-6 like protein EsxT
  • MTBC0 PGAP product: WXG100 family type VII secretion target
  • Pfam (hmmscan --cut_ga): WXG100 PF06013.19 (E=2e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217961.1)
  • Domains: Pfam-A via hmmscan --cut_ga — WXG100 (PF06013.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4842
  • Curated reference: UniProt I6YC53 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 85.4)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 66 functional partner(s); context anchor esxU
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003663|Rv3444c|esxT
MNADPVLSYNFDAIEYSVRQEIHTTAARFNAALQELRSQIAPLQQLWTREAAAAYHAEQLKWHQAASALNEILIDLGNAVRHGADDVAHADRRAAGAWAR