esxT Family assigned · medium auto-curated
H37Rv Rv3444c · MTBC0 mtbc0_003663 ·
100 aa · 3888509–3888811 (-) ·
RefSeq NP_217961.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ESAT-6 like protein EsxT |
|---|---|
| MTBC0 PGAP re-annotation | WXG100 family type VII secretion target |
| Revised (this work) | WXG100 family type VII secretion target. Pfam: WXG100 (PF06013.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6YC53
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | ESAT-6-like protein EsxT |
| Curated function | Induces apoptosis of host cells via activation of NF-kappa-B. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | esxT |
| eggNOG description | Belongs to the WXG100 family |
| Orthologous group | COG4842 |
| KEGG orthology |
K14956
|
| KEGG pathways |
map05152
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.154 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
WXG100 | PF06013.19 | 2.1e-10 | 18–92 | Proteins of 100 residues with WXG |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: esxU (ESAT-6 like protein EsxU), high confidence from genomic context alone (score 974 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3445c esxU |
ESAT-6 like protein EsxU | 998 | 974 ctx | neighborhood:857 coexpression:827 textmining:948 |
Rv3447c eccC4 |
ESX-4 secretion system protein EccC4 | 876 | 863 ctx | neighborhood:792 |
Rv3446c hyp |
hypothetical protein | 891 | 857 ctx | neighborhood:792 |
Rv3449 mycP4 |
membrane-anchored mycosin | 809 | 778 ctx | neighborhood:720 |
Rv3448 eccD4 |
ESX-4 secretion system protein EccD4 | 781 | 762 ctx | neighborhood:720 |
Rv3443c rplM |
50S ribosomal protein L13 | 730 | 730 ctx | neighborhood:728 |
Rv3244c lpqB |
lipoprotein LpqB | 670 | 671 ctx | cooccurence:659 |
Rv0129c fbpC |
diacylglycerol acyltransferase/mycolyltransferase Ag85C | 690 | 651 ctx | cooccurence:650 |
Rv2488c |
LuxR family transcriptional regulator | 651 | 651 | coexpression:651 |
Rv2743c hyp |
hypothetical protein | 618 | 618 ctx | cooccurence:617 |
Rv3903c cpnT hyp |
hypothetical protein | 620 | 606 | coexpression:580 |
Rv0756c hyp |
hypothetical protein | 594 | 594 ctx | cooccurence:587 |
Rv0996 |
transmembrane protein | 588 | 588 ctx | cooccurence:587 |
Rv3803c fbpD |
MPT51/MPB51 antigen | 582 | 582 ctx | cooccurence:581 |
Rv3668c |
protease | 572 | 572 ctx | cooccurence:572 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ESAT-6 like protein EsxT
- MTBC0 PGAP product: WXG100 family type VII secretion target
- Pfam (hmmscan --cut_ga): WXG100 PF06013.19 (E=2e-10)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217961.1)
- Domains: Pfam-A via hmmscan --cut_ga — WXG100 (PF06013.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG4842 - Curated reference: UniProt I6YC53 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
66 functional partner(s); context anchor
esxU - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003663|Rv3444c|esxT MNADPVLSYNFDAIEYSVRQEIHTTAARFNAALQELRSQIAPLQQLWTREAAAAYHAEQLKWHQAASALNEILIDLGNAVRHGADDVAHADRRAAGAWAR