PE_PGRS12 Family assigned · medium auto-curated
H37Rv Rv0832 · MTBC0 - ·
137 aa · 924951–925364 (+) ·
RefSeq YP_177759.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | PE-PGRS family protein PE_PGRS12 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | PE-PGRS family protein PE_PGRS12. Pfam: PE (PF00934.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
Q79FV8
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | PE-PGRS family protein PE_PGRS12 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversionO Post-translational modification, protein turnover, chaperones
|
|---|---|
| eggNOG description | amine dehydrogenase activity |
| Orthologous group | COG3391 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 10.08% of strains (14642) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PE | PF00934.26 | 3.3e-29 | 4–93 | PE family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: PE_PGRS13 (PE-PGRS family protein PE_PGRS13), high confidence from genomic context alone (score 773 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2133c hyp |
hypothetical protein | 871 | 863 | experimental:772 database:425 |
Rv2555c alaS |
alanine--tRNA ligase | 848 | 836 | experimental:570 database:622 |
Rv0833 PE_PGRS13 |
PE-PGRS family protein PE_PGRS13 | 811 | 773 ctx | neighborhood:773 |
Rv2101 helZ |
helicase HelZ | 779 | 766 | database:613 |
Rv2267c stf3 hyp |
hypothetical protein | 778 | 766 | experimental:454 database:583 |
Rv3529c hyp |
hypothetical protein | 778 | 766 | experimental:454 database:583 |
Rv1691 hyp |
hypothetical protein | 778 | 766 | experimental:454 database:583 |
Rv0719 rplF |
50S ribosomal protein L6 | 743 | 743 | experimental:415 database:579 |
Rv0722 rpmD |
50S ribosomal protein L30 | 740 | 740 | database:543 |
Rv3457c rpoA |
DNA-directed RNA polymerase subunit alpha | 747 | 738 | database:622 |
Rv0697 mftG |
dehydrogenase | 739 | 729 | database:573 |
Rv1279 |
GMC-type oxidoreductase | 739 | 729 | database:573 |
Rv3409c choD |
cholesterol oxidase | 739 | 729 | database:573 |
Rv0492c |
GMC-type oxidoreductase | 739 | 729 | database:573 |
Rv1390 rpoZ |
DNA-directed RNA polymerase subunit omega | 720 | 719 | database:624 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE-PGRS family protein PE_PGRS12
- Pfam (hmmscan --cut_ga): PE PF00934.26 (E=3e-29)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177759.1)
- Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3391 - Curated reference: UniProt Q79FV8 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
104 functional partner(s); context anchor
PE_PGRS13 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0832|PE_PGRS12 MSYVSVLPATLATAATEVARIGSALSLASAVAAAQTSAVQAAAADEVSAAIAALFSAHGRDFQALSARAAAFHHEFVQALAAGAGSYAVAEIAAASPLQSLIDVFNAPIQAATGRPLIGNGANGQPGTGAPGGPAGG